DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and LOC116408674

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_031752209.1 Gene:LOC116408674 / 116408674 -ID:- Length:392 Species:Xenopus tropicalis


Alignment Length:222 Identity:59/222 - (26%)
Similarity:100/222 - (45%) Gaps:19/222 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 CGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVV 199
            |.|:|::.:::.|||||.       ..|:...|.....|.||.  :..:..:..:|...|...:.
 Frog     8 CTGTVLNNQWIFTAAHCF-------RHLNGENDIKSLQVVLGA--HLLSEKEKHIQVLNVKQIIQ 63

  Fly   200 HPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSG--NDVQQVTAAGWGFTADGVKSS 262
            |..||.:.:..    ||||::|::..:.||:|...|||..|.  ..:.:...||||...:|.:..
 Frog    64 HELYDPKVQYY----DIALIQLNKPVQLNDYVQPACLPMSSATLEPLTECYLAGWGVRDEGDEPV 124

  Fly   263 HLL-KVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIG 326
            .:: :|.::|.:.:.|.|....:|. ....|| |..:...:|.|||..|:..:... ..:..|||
 Frog   125 AIMQEVKVERINSKRCNKTYLGAIQ-EYHLCA-SQKANMKSCQGDSAAPLMCKRKT-STIFSVIG 186

  Fly   327 IVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            |.|:|..|.....|.:||....:..|:
 Frog   187 IASWGSGCSQINSPGIYTSTKDFVKWM 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 59/222 (27%)
Tryp_SPc 102..353 CDD:214473 58/220 (26%)
LOC116408674XP_031752209.1 Tryp_SPc 2..212 CDD:238113 58/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.