DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and LOC116407662

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_031749278.1 Gene:LOC116407662 / 116407662 -ID:- Length:329 Species:Xenopus tropicalis


Alignment Length:269 Identity:81/269 - (30%)
Similarity:121/269 - (44%) Gaps:52/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            ||||..:...:.|:.|::  ..|:|.:      |||:::..::|||||.|||::           
 Frog    41 IVGGQDSKKGQHPWQAIV--WHPSKVR------CGGTLISSRYVLTAAQCLESE----------- 86

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
            :....:|.||.  ||.|.:.......:|...::|..|:..|    |..||||:||.....|.|.:
 Frog    87 NDTSVIVILGA--YNITGNHKEEVSVKVNRIILHHRYNDSD----FPYDIALLELSNSVPFTDFI 145

  Fly   232 AAVCLPPDSGNDV--QQVTAAGWGFT-ADGVKSSHLL-------KVNLQRFSDEVCQKRLRF--- 283
            ...||||.....:  ......|||.| .|..|...::       .::||.     |:...:.   
 Frog   146 LPACLPPFPTEFLPGHSCLVTGWGDTDYDSTKPKPVILQEAGVRLIDLQH-----CRDLYKLVTN 205

  Fly   284 -SIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ--VIGIVSYGLVCGSQGLPSVYTK 345
             ||.|....||..:..:...|.||.|||: |.|    ..:|  ::|:||:|..|| .|:|.|||.
 Frog   206 DSIITENMTCAMDIHGKRSFCRGDGGGPL-VCH----AGEQWFLVGVVSFGYGCG-HGIPGVYTS 264

  Fly   346 VHLYTDWIE 354
            |..|.|||:
 Frog   265 VPAYVDWIK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/269 (30%)
Tryp_SPc 102..353 CDD:214473 79/266 (30%)
LOC116407662XP_031749278.1 Tryp_SPc 41..275 CDD:238113 81/269 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.