DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CTRC

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_011538852.1 Gene:CTRC / 11330 HGNCID:2523 Length:280 Species:Homo sapiens


Alignment Length:219 Identity:55/219 - (25%)
Similarity:78/219 - (35%) Gaps:76/219 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SACQSTPF-------IVGGTKASGKEFPFMALIGTHRPNKSKSDINW--DCGGSVVHPKFVLTAA 149
            |:|....|       :|||..|....:|:...:     ...|:| .|  .|||:::...||||||
Human    15 SSCGVPSFPPNLSARVVGGEDARPHSWPWQISL-----QYLKND-TWRHTCGGTLIASNFVLTAA 73

  Fly   150 HCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQG--- 211
            ||:.                           |:.|       :||.  |.....:.||||..   
Human    74 HCIS---------------------------NTRT-------YRVA--VGKNNLEVEDEEGSLFV 102

  Fly   212 ---------------FKNDIALVELDRKAEFNDHVAAVCLPPDSG---NDVQ-QVTAAGWGFTAD 257
                           .:|||||::|....|.:|.:...|||....   .|.. .||  |||....
Human   103 GVDTIHVHKRWNALLLRNDIALIKLAEHVELSDTIQVACLPEKDSLLPKDYPCYVT--GWGRLWR 165

  Fly   258 GVKSSHLLKVNLQRFSDEVCQKRL 281
            |::....|.|. :||...|..::|
Human   166 GLRWPTELPVG-ERFLGGVWHRQL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 52/204 (25%)
Tryp_SPc 102..353 CDD:214473 52/204 (25%)
CTRCXP_011538852.1 Tryp_SPc 29..>163 CDD:214473 45/177 (25%)
Tryp_SPc 30..>173 CDD:238113 46/186 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.