DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP013221

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_003436543.1 Gene:AgaP_AGAP013221 / 11175927 VectorBaseID:AGAP013221 Length:318 Species:Anopheles gambiae


Alignment Length:362 Identity:113/362 - (31%)
Similarity:162/362 - (44%) Gaps:63/362 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IQILLLIASVSVVTEYCDNGTGECKELTPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCPIPLDHQ 71
            |.:|||...:|:    ||..|  .|.::                 |:.|||:..|:.....:...
Mosquito    10 ISLLLLGHLISL----CDGQT--AKRIS-----------------VQKCDEYRRIISNKRGVISL 51

  Fly    72 NLKPAEQTRPFEKQCKQYNEVRSACQS-TPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDC 135
            .|.|    :||..|  .||     |.: ...||||..|...|||..||:|..|.:.|....::.|
Mosquito    52 TLNP----KPFYYQ--SYN-----CSNVVDLIVGGEAAKHGEFPHQALLGYPREDGSPEPYSFSC 105

  Fly   136 GGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVH 200
            |||::..:|:||||||.            ::..| .:|||||  |:.|.|.....||.:...:.|
Mosquito   106 GGSLISDRFILTAAHCF------------SYGDP-VIVRLGE--YDLTVDSTTQLDFGIAEIIRH 155

  Fly   201 PGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVK--SSH 263
            |.|    ......:|:|||.|:....|:..:...||..:...:|.:..|.|:|...:|..  |:.
Mosquito   156 PKY----RNSRSYHDLALVRLNETVLFSKVIRPACLWTNPTLNVSRFVATGFGKQEEGSTDLSTK 216

  Fly   264 LLKVNLQRFSDEVC------QKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLK 322
            |:||.|..|....|      .::.|..|| ..|.|.||:....|||.||||||:........|:.
Mosquito   217 LMKVQLDLFPSSDCGELFRDNRKFRDGID-EGQLCVGSLIGGKDTCQGDSGGPLQTITEPRSCIY 280

  Fly   323 QVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVWG 359
            .::|:.|.|..||.....::|:||..|.||||.:|||
Mosquito   281 NIVGVTSTGAACGVGNSKAIYSKVAHYLDWIEQVVWG 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 88/261 (34%)
Tryp_SPc 102..353 CDD:214473 85/258 (33%)
AgaP_AGAP013221XP_003436543.1 Tryp_SPc 72..314 CDD:238113 88/261 (34%)
Tryp_SPc 72..311 CDD:214473 85/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.