DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPB9

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_003436374.1 Gene:CLIPB9 / 11175774 VectorBaseID:AGAP013442 Length:401 Species:Anopheles gambiae


Alignment Length:404 Identity:111/404 - (27%)
Similarity:171/404 - (42%) Gaps:104/404 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EYCDNGT---GECKELTPSDCPVIFYNQHLIGAEVKYCDEF-------------NDIVCCP---- 65
            :.|...|   |.|..:...|..:.::.|.::..|.:   ||             ...||||    
Mosquito    29 QQCTTPTRLRGRCISIYECDSILDYFKQRILTWEER---EFLRKSQCTGATSGRQPFVCCPGNGS 90

  Fly    66 ---------IPLDHQNLKPAEQT--------------------RPFEKQCKQYNEVRSACQSTPF 101
                     :|....:..||...                    .|.:.:|.....:|        
Mosquito    91 KPVVAPATTVPAGTASTTPAGPAATAPSGDAALADQLVGGLLPNPKKNECGVSIGMR-------- 147

  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |.||..|...|||::||:   :....|.:..:.||||:::.::|||||||:   ..:.||.:...
Mosquito   148 IYGGQNADIDEFPWLALL---QYENRKGERKYSCGGSLINRRYVLTAAHCV---IGEVERKEGKL 206

  Fly   167 DSPKFVVRLGELDYNSTTD-DALVQ-----------DFRVVNYVVHPGYDTEDEEQGFKNDIALV 219
            .|    |||||  ||:.|: |.:.:           |..:.:.:|||||    ::....:||||:
Mosquito   207 VS----VRLGE--YNTKTEIDCVTEEQEEICADPPIDAGIESVIVHPGY----QDMAHADDIALL 261

  Fly   220 ELDRKAEFNDHVAAVCLP-----PDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQK 279
            .|.:..|:...|..||||     .....:|..||  |:|.|....:|:...|:.::.:....||:
Mosquito   262 RLAQSIEYTSFVQPVCLPLTDFRASKTGEVNFVT--GFGRTLQESRSAVKQKLGIKVYDHARCQE 324

  Fly   280 R--LRFSIDTRTQFCAGSMSSQADTCNGDSGGPIF-VQHPLYPCLKQVIGIVSYGLVCGSQGLPS 341
            :  .:.|..|..|.|||...:: |:|:||||||:. :|...|     :.||||||..||.:..|.
Mosquito   325 KYATKNSSITTNQLCAGGEYAK-DSCHGDSGGPLMKLQKVWY-----LEGIVSYGNRCGLEDWPG 383

  Fly   342 VYTKVHLYTDWIES 355
            |||.|..|..|:.|
Mosquito   384 VYTHVPAYMAWVRS 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 92/274 (34%)
Tryp_SPc 102..353 CDD:214473 90/270 (33%)
CLIPB9XP_003436374.1 CLIP 31..85 CDD:288855 10/56 (18%)
Tryp_SPc 147..395 CDD:214473 91/279 (33%)
Tryp_SPc 148..398 CDD:238113 92/274 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.