DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP012946

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_003436544.1 Gene:AgaP_AGAP012946 / 11175517 VectorBaseID:AGAP012946 Length:318 Species:Anopheles gambiae


Alignment Length:306 Identity:104/306 - (33%)
Similarity:143/306 - (46%) Gaps:38/306 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LDHQNLKPAEQT------RPFEKQCKQYNEVRSACQS-TPFIVGGTKASGKEFPFMALIGTHRPN 125
            |::||:....||      :|...|.:.||     |.: ...||||.:|...|||..||:|..:.|
Mosquito    33 LEYQNIVVNRQTLIPLTIKPKPIQFEVYN-----CTNVVQLIVGGEQAKYGEFPHHALLGFSKEN 92

  Fly   126 KSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQ 190
            .::.|.::.|||:::..:.:||||||....       ||      .:||:||.|....|||....
Mosquito    93 GNQWDYDFRCGGTLISDQHILTAAHCFAYG-------DP------VIVRVGEYDTELETDDEYDS 144

  Fly   191 DFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGF- 254
            |...:..  ||.|.....    .:|||||:|......:.|:...||......:..:..|.|:|: 
Mosquito   145 DIASIRR--HPNYSNLRS----YDDIALVKLKHPIVLSKHIRPACLWETEERNSTRYIATGFGYN 203

  Fly   255 -TADGVKSSHLLKVNLQRFSDEVCQKRL----RFSIDTRT-QFCAGSMSSQADTCNGDSGGPIFV 313
             |.....|:.::||||..|....|::..    ||....|. |.|.||:....|||.||||||:.|
Mosquito   204 ETYGTTLSTVMMKVNLDEFPVSDCERNFKGDRRFKQGVRDGQLCVGSIVEGRDTCQGDSGGPLQV 268

  Fly   314 QHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVWG 359
            ......|...|:||.|.|.|||.....::||||..|.||||..|||
Mosquito   269 VTNTKSCSYGVVGITSVGGVCGIGNAKAIYTKVSHYIDWIEDNVWG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 91/260 (35%)
Tryp_SPc 102..353 CDD:214473 88/257 (34%)
AgaP_AGAP012946XP_003436544.1 Tryp_SPc 69..311 CDD:238113 91/260 (35%)
Tryp_SPc 69..308 CDD:214473 88/257 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.