DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and LOC110439063

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_021329148.1 Gene:LOC110439063 / 110439063 -ID:- Length:306 Species:Danio rerio


Alignment Length:265 Identity:77/265 - (29%)
Similarity:115/265 - (43%) Gaps:45/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            ||.|.:|.....|:|..:.....|        .|.|.::..:||||||.|...:. ||       
Zfish    80 IVDGQEAKPHSRPYMVSVQLFGQN--------ICAGFLISDRFVLTAAQCWHHNR-KA------- 128

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
                ..|.:|..|.......   :.|:|:.::.||.::::.    |:|||.|::|.||...|:.:
Zfish   129 ----LTVVVGAHDLRKCQHS---KHFKVMCHITHPEFNSKT----FENDIMLLKLKRKVPLNNKI 182

  Fly   232 AAVCLPPDSGNDVQQVT---AAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFC 292
            ..:.| |.:|...:..|   .|||| ...||..|..||:......:|..|:.|..:........|
Zfish   183 RPISL-PKNGERFKADTLCSVAGWGRLWTDGPVSDLLLEAKTAIVNDAECKLRWGYHYVPSMMIC 246

  Fly   293 AGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSY--GLVCGSQGLPSVYTKVHLYTDWIES 355
            |   .....:||||.|||:.       |....:||..:  ..:|.|:.||:||||:..|..||.|
Zfish   247 A---FGHGGSCNGDGGGPLV-------CGNTAVGITIFRDRYLCNSRLLPNVYTKISAYVPWIRS 301

  Fly   356 IVWGN 360
            |: ||
Zfish   302 II-GN 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/259 (28%)
Tryp_SPc 102..353 CDD:214473 71/256 (28%)
LOC110439063XP_021329148.1 Tryp_SPc 80..302 CDD:238113 73/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.