DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and PRSS21

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:281 Identity:78/281 - (27%)
Similarity:123/281 - (43%) Gaps:56/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWD---CGGSVVHPKFVLTAAHCLETDESKAE 160
            |..||||..|....:|:...:..           ||   ||.|::..::.||||||.||   .::
Human    39 TSRIVGGEDAELGRWPWQGSLRL-----------WDSHVCGVSLLSHRWALTAAHCFET---YSD 89

  Fly   161 RLDPNFDSPKFVVRLGELDYNST--TDDALVQDFRVVNYVVHPGYDTEDEEQGFKN---DIALVE 220
            ..||:    .::|:.|:|....:  :..|....:.|.|..:.|.|        ..|   |||||:
Human    90 LSDPS----GWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRY--------LGNSPYDIALVK 142

  Fly   221 LDRKAEFNDHVAAVCLPPDSGNDVQQVT---AAGWGFTA--DGVKSSHLL-KVNLQRFSDEVCQK 279
            |.....:..|:..:||.. |..:.:..|   ..|||:..  :.:.|.|.| :|.:...::.:|..
Human   143 LSAPVTYTKHIQPICLQA-STFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNH 206

  Fly   280 R-LRFSIDT---RTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ----VIGIVSYGLVCGS 336
            . |::|...   ....|||:.....|.|.||||||:       .|.|.    .||:||:|:.||.
Human   207 LFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPL-------ACNKNGLWYQIGVVSWGVGCGR 264

  Fly   337 QGLPSVYTKVHLYTDWIESIV 357
            ...|.|||.:..:.:||:.::
Human   265 PNRPGVYTNISHHFEWIQKLM 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/275 (28%)
Tryp_SPc 102..353 CDD:214473 75/272 (28%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 77/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.