DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Try5

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:264 Identity:78/264 - (29%)
Similarity:115/264 - (43%) Gaps:46/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI--GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            ||||........|:...:  |.|           .||||:::.::|::||||.:|          
Mouse    24 IVGGYTCRENSIPYQVSLNSGYH-----------FCGGSLINDQWVVSAAHCYKT---------- 67

  Fly   165 NFDSPKFVVRLGELDYNSTT-DDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
                 :..|||||.:.|... ::..|...:::.   ||.:::    :...|||.|::|......|
Mouse    68 -----RIQVRLGEHNINVLEGNEQFVNSAKIIK---HPNFNS----RTLNNDIMLIKLASPVTLN 120

  Fly   229 DHVAAVCLPPDSGNDVQQVTAAGWGFTAD-GVKSSHLLK-VNLQRFSDEVCQKRLRFSIDTRTQF 291
            ..||.|.||........|...:|||.|.. ||.:..||: ::........|:......| |....
Mouse   121 ARVATVALPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEASYPGKI-TNNMI 184

  Fly   292 CAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESI 356
            |.|.:....|:|.||||||:.       |..|:.||||:|..|..:..|.|||||..|.|||:..
Mouse   185 CVGFLEGGKDSCQGDSGGPVV-------CNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDT 242

  Fly   357 VWGN 360
            :..|
Mouse   243 IAAN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/258 (30%)
Tryp_SPc 102..353 CDD:214473 75/255 (29%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 75/255 (29%)
Tryp_SPc 24..242 CDD:238113 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.