DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and LOC102553861

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001316820.1 Gene:LOC102553861 / 102553861 RGDID:7500593 Length:248 Species:Rattus norvegicus


Alignment Length:258 Identity:83/258 - (32%)
Similarity:112/258 - (43%) Gaps:41/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |:||.:|.....|:||.: .::...|:..|   |||.::...||||||||               
  Rat    21 IIGGHEADPHSRPYMAYL-QYKNEDSRDTI---CGGFLIREDFVLTAAHC--------------- 66

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
            ...|..|.||.  :|....:...|...||..:.||.|:.:.    ..|||.|::|..||:....|
  Rat    67 SGSKINVTLGA--HNIKEQEKTQQVIPVVKIIPHPAYNAKT----ISNDIMLLKLKSKAKRTRAV 125

  Fly   232 AAVCLPPDS----GNDVQQVTAAGWGFTAD-GVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQF 291
            ..:.||..:    ..||..|  ||||.... |.....|.:|.|....|:.|:..|:.:.|...|.
  Rat   126 KTLSLPRSNFKVKPGDVCYV--AGWGKLGPMGKFPDKLQEVELTVQEDQECETYLKNAYDKANQI 188

  Fly   292 CAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354
            |||....:..:..||||||:.       |.|...||||||...||  .|..:|||..:..|||
  Rat   189 CAGDPKIKCASFQGDSGGPLV-------CKKVAAGIVSYGRKDGS--TPRAFTKVSTFLSWIE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/258 (32%)
Tryp_SPc 102..353 CDD:214473 80/255 (31%)
LOC102553861NP_001316820.1 Tryp_SPc 20..241 CDD:214473 80/255 (31%)
Tryp_SPc 21..244 CDD:238113 83/258 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.