DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and LOC101886682

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_005170582.2 Gene:LOC101886682 / 101886682 -ID:- Length:252 Species:Danio rerio


Alignment Length:267 Identity:77/267 - (28%)
Similarity:116/267 - (43%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWD--CGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            |..||:|.....|:|..:          .||..  ||||::..:||||||||.:.|:        
Zfish    27 IEDGTEAKPHSRPYMVSL----------QINSQHICGGSLISKEFVLTAAHCWDKDD-------- 73

  Fly   165 NFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND 229
                 ...|..|..|...   .|:...|:|.:|:.||.|::...|    |||.|::|..|...::
Zfish    74 -----VLTVVTGAHDLRK---KAIYNTFKVTSYIPHPDYNSYTLE----NDIMLLKLKTKVRLSN 126

  Fly   230 HVAAVCLPPDSGNDVQQVT---AAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQ 290
            .|..:.| |.:|.|::..|   .|||| ....|.|:..|.:......:|..|::|..........
Zfish   127 SVGLISL-PRNGEDLKADTLCSIAGWGRLWRKGAKTDRLREAETVIVNDAECERRWESDYVASKM 190

  Fly   291 FCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYG--LVCGSQGLPSVYTKVHLYTDWI 353
            .||   .....||:||||||:.       |....:||.::.  .:|.|:..|.|:.::..|..||
Zfish   191 ICA---YGHGGTCSGDSGGPLV-------CNNTAVGITAFSDRYLCKSRLFPDVFARISAYLPWI 245

  Fly   354 ESIVWGN 360
            ::|. ||
Zfish   246 QNIT-GN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/261 (28%)
Tryp_SPc 102..353 CDD:214473 72/258 (28%)
LOC101886682XP_005170582.2 Tryp_SPc 27..248 CDD:238113 74/261 (28%)
Tryp_SPc 27..245 CDD:214473 72/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.