DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and LOC101733280

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_031752096.1 Gene:LOC101733280 / 101733280 -ID:- Length:421 Species:Xenopus tropicalis


Alignment Length:272 Identity:70/272 - (25%)
Similarity:114/272 - (41%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |:||.......:|:...| .|...|   |....||||:::.|:|||||.|....::....|...|
 Frog    29 IIGGHHTQAGAWPWAVSI-QHGNGK---DYTHFCGGSILNVKWVLTAASCFTKYKNSLNTLRLVF 89

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
            .: ..:.|||          ..||..::...::|..|...:..   .:|||||||:...::||:.
 Frog    90 GA-HHLARLG----------PEVQFGKIKQLIIHENYSPIERP---THDIALVELEAAIKYNDYT 140

  Fly   232 AAVCLPPDSGN--DVQQVTAAGWGFTADGVKSSHLL----KVNLQRFSDEVCQKRLRFSIDTRT- 289
            ...|:|..:.|  :......:.|||..:....:..:    :||:  ...:.|..:..:....:. 
 Frog   141 QPACIPAITVNVEEKDDCYVSAWGFLNESPTETLTIMQEAQVNI--IPKKTCNSKQWYKGKIKDF 203

  Fly   290 QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLK------QVIGIVSYGLVCGSQGLPSVYTKVHL 348
            ..||...|..:|:|.||.|||:       .|.:      .|:||...|..|..:..|.|||....
 Frog   204 SLCAHYTSENSDSCLGDVGGPL-------TCRRIDAYTYMVVGIAGSGYGCPKEKQPHVYTATQH 261

  Fly   349 YTDWIESIVWGN 360
            |.:||...::|:
 Frog   262 YIEWIGVKIYGD 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 69/266 (26%)
Tryp_SPc 102..353 CDD:214473 67/263 (25%)
LOC101733280XP_031752096.1 Tryp_SPc 28..266 CDD:214473 67/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.