DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and LOC101733035

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_031749230.1 Gene:LOC101733035 / 101733035 -ID:- Length:216 Species:Xenopus tropicalis


Alignment Length:105 Identity:30/105 - (28%)
Similarity:45/105 - (42%) Gaps:15/105 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 VKSSHLLKVNLQRFSDEVCQKRLRFSI-DTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLK 322
            ::.|.:..::|:|..|...:......| ||.|  ||..:........||.|||:.       |.|
 Frog    68 LQESEVQLISLERCRDLYREAYTNILIADTMT--CAMDIHENTGISTGDLGGPLV-------CQK 123

  Fly   323 Q----VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVW 358
            .    ::|:||..::. ...||..||.|..|.|||...|:
 Frog   124 GGQWFLVGVVSLEVIL-ELTLPVSYTSVPAYMDWINKHVF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 29/101 (29%)
Tryp_SPc 102..353 CDD:214473 27/98 (28%)
LOC101733035XP_031749230.1 Tryp_SPc <19..160 CDD:419748 29/101 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.