DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and tmprss2.15

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:414 Identity:110/414 - (26%)
Similarity:164/414 - (39%) Gaps:110/414 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QILLLIASVSVV-TEYCD------NGTGE--CKEL----------TPSDC---PVIFYNQHLIGA 50
            |:|...:.|.|: :::||      |||.|  |..|          :|:..   ||.:        
 Frog   128 QMLCGSSGVCVLYSQWCDGIPQCPNGTDEQTCVRLYGPNFQLQAYSPAKATWLPVCY-------- 184

  Fly    51 EVKYCDEFND----IVCCPI----------------------PLDHQNLKPAEQTR-PFEKQCKQ 88
                 ||::|    |.|..|                      .|...|:.....|. .:...|..
 Frog   185 -----DEWSDNSGKIACQDIGYSMSSYYQSSQLLASSSNGYFVLQSSNVTGKMYTNLNYSATCAS 244

  Fly    89 YNEVRSACQSTPF-------IVGGTKASGKEFPF----MALIGTHRPNKSKSDINWDCGGSVVHP 142
            .|.|...|.|...       |||||.||..::|:    :.|:||.         .:.||||::.|
 Frog   245 GNMVSLRCISCGLSTKVDSRIVGGTPASVGDWPWQVELLKLVGTS---------IYLCGGSIITP 300

  Fly   143 KFVLTAAHCLETDESKAERLDPNFDSPK-FVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTE 206
            .:::|||||:....|          :|. |.|..|.|    |........:.|...:|||.|.:.
 Frog   301 HWIVTAAHCVYGSTS----------TPSAFKVFAGSL----TIQSYYSAGYTVERALVHPSYSSY 351

  Fly   207 DEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSG---NDVQQVTAAGWGFTADGVK-SSHLLKV 267
            .:..    |:||::|.....|..::..||| |:.|   .:.|....:|||.||:|.. |.:|:..
 Frog   352 TQIY----DVALLKLTAALVFTTNLRPVCL-PNVGMPWAEGQPCWISGWGTTAEGGSISKNLMAA 411

  Fly   268 NLQRFSDEVC-QKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYG 331
            ::...|...| |..:.....:.|..|||.:|...|||.||||||:..:   ...|..::|..|:|
 Frog   412 SVPIISSTTCNQAAVYGGAISSTMMCAGYLSGGTDTCQGDSGGPLVTK---TNSLWWLVGDTSWG 473

  Fly   332 LVCGSQGLPSVYTKVHLYTDWIES 355
            ..|.....|.||..|.::.:||.|
 Frog   474 YGCARAYKPGVYGNVTVFIEWIYS 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/264 (31%)
Tryp_SPc 102..353 CDD:214473 78/260 (30%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055 17/107 (16%)
Tryp_SPc 265..498 CDD:238113 81/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.