DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and LOC101732176

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:488 Identity:110/488 - (22%)
Similarity:165/488 - (33%) Gaps:184/488 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QILLLIASVSVV-----------TEYCDNGT--GECKELTP-----------------SDCP--- 39
            :||.:::||.|:           :.|..|.|  ..||:  |                 ||||   
 Frog    66 KILCIVSSVCVLLAAAIIIAVLCSVYAQNRTIGSNCKK--PCGANGTSVLCSQWCDGKSDCPNGE 128

  Fly    40 --------------------VIFYNQHLIGAEVKYCDEFNDIVCCPIPLDHQN------------ 72
                                .:.|.|        :||..:.   ||...|.|.            
 Frog   129 DEESCVETKACQMTCGTTGICVLYTQ--------WCDGISQ---CPSGEDEQTCVRLYGPSFQLQ 182

  Fly    73 -LKPAEQT-RPFEKQCKQYNEVRSACQSTPF---------------------------------- 101
             ..||:.| .|........|..::|||...:                                  
 Frog   183 AYSPAKATWLPVCYDSWSDNSGKTACQDIGYSMSTYLGSSQILASSSNGYVKLKSSTVTGKLYKN 247

  Fly   102 -----------------------------IVGGTKASGKEFPF----MALIGTHRPNKSKSDINW 133
                                         |||||.|...::|:    |.|:||..         :
 Frog   248 LQYSATCTTGTMVSLRCINCGLSTKVDNRIVGGTFALAGDWPWQISLMKLVGTSL---------Y 303

  Fly   134 DCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPK-FVVRLGELDYNSTTDDALVQDFRVVNY 197
            .||||::.|.:::|||||:....|          ||. |.|..|.|    |..:.....:.|...
 Frog   304 LCGGSIITPYWIVTAAHCVYGYTS----------SPSIFKVFAGSL----TLSNYYSAGYLVDRV 354

  Fly   198 VVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSG---NDVQQVTAAGWGFTAD-G 258
            ::||.|....:..    ||||::|.....|:.::..||| |:.|   .|.|....:|||.|:: |
 Frog   355 LIHPSYSPNTQNY----DIALLKLKTALVFSTNLRPVCL-PNVGMPWADGQPCWISGWGTTSEAG 414

  Fly   259 VKSSHLLKVNLQRFSDEVCQKRLRF-SIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLK 322
            ..|:.|...::...|...|.....: .:.:.|..|||.:....|||.||||||:..:   ...|.
 Frog   415 SISTSLKAASVPIISSATCNLAPVYGGVISPTMICAGYLGGGTDTCQGDSGGPLVTK---TNSLW 476

  Fly   323 QVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIES 355
            .::|..|:|..|.....|.||..:.::.:||.|
 Frog   477 WLVGDTSWGYGCARAYKPGVYGNITVFLEWIYS 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/264 (30%)
Tryp_SPc 102..353 CDD:214473 76/260 (29%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060 4/17 (24%)
LDLa 140..171 CDD:238060 8/41 (20%)
SRCR_2 176..271 CDD:406055 8/94 (9%)
Tryp_SPc 277..510 CDD:238113 79/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.