DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and prss59.2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001268923.1 Gene:prss59.2 / 100535672 ZFINID:ZDB-GENE-110408-10 Length:242 Species:Danio rerio


Alignment Length:264 Identity:82/264 - (31%)
Similarity:119/264 - (45%) Gaps:47/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI--GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            ||||.:......|:.|.:  |.|           .||||:|...:|::||||.::      ||: 
Zfish    21 IVGGYECQPNSQPWQASLNSGYH-----------FCGGSLVSEYWVVSAAHCYKS------RLE- 67

  Fly   165 NFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYD--TEDEEQGFKNDIALVELDRKAEF 227
                    |||||  :|...::...|.......:.:|.||  |.|      :||.|::|.:.|..
Zfish    68 --------VRLGE--HNIVINEGTEQFITSEKVIRNPNYDSWTID------SDIMLIKLSKPATL 116

  Fly   228 NDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVKSSHLLK-VNLQRFSDEVCQKRLRFSIDTRTQF 291
            |.:|..|.||.....|......:|||.|......|:.|: :.:...||..|:......| |.|.|
Zfish   117 NKYVQPVALPNGCAADGTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCKNSYPGMI-TDTMF 180

  Fly   292 CAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESI 356
            |||.:....|:|.||||||:.       |..::.||||:|..|..:..|.||.||.:::.||...
Zfish   181 CAGYLEGGKDSCQGDSGGPVV-------CNGELQGIVSWGYGCAQKDNPGVYGKVCMFSQWIADT 238

  Fly   357 VWGN 360
            :..|
Zfish   239 MRNN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/258 (31%)
Tryp_SPc 102..353 CDD:214473 79/255 (31%)
prss59.2NP_001268923.1 Tryp_SPc 20..235 CDD:214473 79/255 (31%)
Tryp_SPc 21..238 CDD:238113 81/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.