DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and XB5892359

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_031752073.1 Gene:XB5892359 / 100497443 XenbaseID:XB-GENE-5892360 Length:426 Species:Xenopus tropicalis


Alignment Length:298 Identity:74/298 - (24%)
Similarity:130/298 - (43%) Gaps:73/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKF 144
            ||.   .:.::.||.       ::.|..|....:|:  ::....|  ..|.....|||:|::..:
 Frog    11 RPL---ARSHHRVRR-------VIDGANAQPGSWPW--IVSIQMP--IDSVYRHVCGGTVLNHHW 61

  Fly   145 VLTAAHCL---ETDESKAERLDPNFD----SPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPG 202
            |:||||||   ::::|.|..:...|:    .|:..:|                  ::...:.|..
 Frog    62 VMTAAHCLLKYQSEQSLARIVFGLFNVSDLGPETQIR------------------KIKEMIRHEH 108

  Fly   203 YDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVT---AAGWGFTAD--GVKSS 262
            ::.::.    ||||||:.|||...|:|::...|||..| :|:.::.   .||||...|  .:::.
 Frog   109 FNKKEN----KNDIALIYLDRPVAFSDYIQPACLPQQS-SDITRMNDCYIAGWGLVDDYFRIRTD 168

  Fly   263 HLLKVNLQRFSDEVCQK------RLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCL 321
            .|.:...:..::..|.:      |::     ....|||......|||:||||||:.       |.
 Frog   169 VLQEAKTELIANSRCNQSDWYNGRIK-----EYNLCAGFEHGGPDTCDGDSGGPLM-------CK 221

  Fly   322 KQ------VIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            :.      ::||.|:|.:||......|||....:.:||
 Frog   222 RMKAKTYYIVGIASWGGLCGHSYRNGVYTATQYFKEWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 70/276 (25%)
Tryp_SPc 102..353 CDD:214473 68/274 (25%)
XB5892359XP_031752073.1 Tryp_SPc 22..259 CDD:214473 68/282 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.