DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and XB5962685

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_002941155.3 Gene:XB5962685 / 100496550 XenbaseID:XB-GENE-5962686 Length:251 Species:Xenopus tropicalis


Alignment Length:270 Identity:78/270 - (28%)
Similarity:126/270 - (46%) Gaps:51/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 STPFIVGGTKASGKE-FP----FMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDES 157
            :||...|.....||| .|    :|||:      ::.|::   |||:::...:|||||.|      
 Frog    14 NTPICAGMGITGGKEAIPHARRYMALV------RTGSNL---CGGTLIKDNWVLTAATC------ 63

  Fly   158 KAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELD 222
            |.:|..        .|.||.  ::..|.:.|.|.|:|..:|.|..:|    .:.:.|::.|::|.
 Frog    64 KVDRTT--------TVDLGV--HSIKTMNKLRQQFKVARWVPHQKFD----RRSYVNNLQLLQLS 114

  Fly   223 RKAEFNDHVAAVCLPPDSGNDVQQVT---AAGWGFTADGVK--SSHLLKVNLQRFSDEVCQKRLR 282
            .||.|: :...:.|.|....|::..|   .||||.||...|  |..|::|:|.......|..:.:
 Frog   115 SKANFS-YAVNILLLPTKYKDIKPGTVCETAGWGITAYNGKQQSDKLMEVSLTVLDRMQCNNQWK 178

  Fly   283 FSID-TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYG-LVCGSQGLPSVYTK 345
            ..|. |:...|......:. .||||.|||:.       |.:.:.|::|:| |:||.:...:|||:
 Frog   179 SKIKITKDMMCTRDKGKRG-FCNGDGGGPLI-------CNRILTGVISFGPLICGMENGANVYTR 235

  Fly   346 V-HLYTDWIE 354
            : ..|..||:
 Frog   236 LTSNYIKWIK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 76/266 (29%)
Tryp_SPc 102..353 CDD:214473 74/263 (28%)
XB5962685XP_002941155.3 Tryp_SPc 23..246 CDD:238113 75/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.