DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and LOC100495541

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_031749237.1 Gene:LOC100495541 / 100495541 -ID:- Length:659 Species:Xenopus tropicalis


Alignment Length:275 Identity:76/275 - (27%)
Similarity:114/275 - (41%) Gaps:64/275 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |||||.|:...:|:...:..|     .|.|   ||||::..::::|||||.|..:|.::      
 Frog   362 IVGGTDATDGAWPWQVSLDYH-----GSHI---CGGSLIATQWIMTAAHCFEYSKSPSD------ 412

  Fly   167 DSPKFVVRLGEL--------DYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDR 223
                :.:|||..        :..||.|..:|               ..........||||:.|..
 Frog   413 ----YKIRLGAYQLSLISPHEITSTVDSIIV---------------NSPNSSSTNTDIALIRLTS 458

  Fly   224 KAEFNDHVAAVCLP--PDSGNDVQQVTAAGWGFTADGVKSSH---LLKVNLQRFSDEVCQKRLRF 283
            ...:..::..:|||  .|...:..:....|||..|..|...:   |.:|.....|...|.:  .:
 Frog   459 PITYTKYILPICLPSTSDGFTEGMECWVTGWGTIASQVNLPYPMTLQQVMTPLISRATCNQ--MY 521

  Fly   284 SIDT-------RTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQV---IGIVSYGLVCGSQG 338
            :.|:       ..|.|||..:.|.|:|.||||||:..|      |:.:   |||||:|..|..:.
 Frog   522 NTDSLLSVVVPLDQICAGYAAGQKDSCQGDSGGPLVCQ------LQGIWYQIGIVSWGEGCAVRN 580

  Fly   339 LPSVYTKVHLYTDWI 353
            .|.|||.|..|..|:
 Frog   581 RPGVYTLVPAYYSWV 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 76/275 (28%)
Tryp_SPc 102..353 CDD:214473 75/273 (27%)
LOC100495541XP_031749237.1 Tryp_SPc 44..283 CDD:238113
Tryp_SPc 362..595 CDD:238113 75/273 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.