DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and f12

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_017947702.2 Gene:f12 / 100493769 XenbaseID:XB-GENE-1004811 Length:597 Species:Xenopus tropicalis


Alignment Length:313 Identity:93/313 - (29%)
Similarity:132/313 - (42%) Gaps:76/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDI 131
            |:|.:...|.:..|.|:|          .....|.||||..|.....|::|.:...         
 Frog   334 PVDGRIDLPVDCGRKFQK----------TPSIMPRIVGGLVALPASHPYIAALYID--------- 379

  Fly   132 NWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVN 196
            |..||||::.|.:::||||||:      :|  ||.  .|..|.||:..:| |||...| ...|..
 Frog   380 NHFCGGSLISPCWIVTAAHCLD------QR--PNV--TKISVVLGQSRFN-TTDQHTV-TLLVEK 432

  Fly   197 YVVHPGY--DTEDEEQGFKNDIALVELDR-----KAEFNDHVAAVCLPPD--SGNDVQQVTAAGW 252
            |::|..|  ||      .::|||||::..     .:||:..|..:|||..  .....:|...|||
 Frog   433 YILHEKYYGDT------LQHDIALVKVKSINGLCASEFSQFVQPICLPQQFKMAESTKQCVVAGW 491

  Fly   253 GFTADGVK--SSHLLKVNLQRFSDEVCQK------RLRFSIDTRTQFCAGSMSSQADTCNGDSGG 309
            |...:|.:  :..|.:.::.......||.      |:     .....|||.|....|.|.|||||
 Frog   492 GHQYEGAEHYAFFLQEASMPIIPYTQCQSPSVHGDRM-----LPGMLCAGFMEGGVDACQGDSGG 551

  Fly   310 PIFVQ-------HPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIES 355
            |:..:       |          |:||:|..|..:..|.|||.|..|||||.:
 Frog   552 PLVCEVDGRIELH----------GVVSWGSGCAEENKPGVYTAVTSYTDWIRA 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 86/278 (31%)
Tryp_SPc 102..353 CDD:214473 84/274 (31%)
f12XP_017947702.2 fn2 46..87 CDD:394995
EGF_CA 95..129 CDD:238011
KR 213..298 CDD:214527
Tryp_SPc 359..595 CDD:238113 86/278 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.