DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and tmprss15

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_031752048.1 Gene:tmprss15 / 100490249 XenbaseID:XB-GENE-999987 Length:994 Species:Xenopus tropicalis


Alignment Length:390 Identity:98/390 - (25%)
Similarity:163/390 - (41%) Gaps:96/390 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CDNGTGE--CKELTPSDCPVIFYNQHLIG-AEVKYCDEF-------------NDIVCCPIPLDHQ 71
            ||:||.|  |..|         :|..:.| .:.|...|:             ||| |..:.|.:.
 Frog   645 CDDGTDERHCVRL---------FNSSMSGLVQFKVQSEWHTACIDHWNEDISNDI-CHRLGLGNV 699

  Fly    72 NLKPA---EQTRPF---------------EKQCKQYNEVRSACQ------------STPFIVGGT 106
            ||..|   |...||               ..||...:.:...||            |...||||:
 Frog   700 NLTSAVLSEGNGPFVTLIQVEDGSLSLLPSDQCANQSVIHIQCQQRECGKRLVPIKSGSKIVGGS 764

  Fly   107 KASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKF 171
            .|:...:|:  ::..:..::.      .||.|:|:.:::::||||:     ....|.|:    .:
 Frog   765 DAALGAWPW--IVSLYYNDRQ------TCGASLVNQEWLVSAAHCV-----YGRNLIPS----NW 812

  Fly   172 VVRLG-ELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVC 235
            ..||| ..:.|.|......|  .:...|::|.|:...::    :||.::.|..|..::|::..:|
 Frog   813 KARLGLHTNLNLTQPQIATQ--MIDQIVINPQYNRRTKD----SDIVMMHLQFKVNYSDYIQPIC 871

  Fly   236 LP-PDSGNDVQ-QVTAAGWGFTADGVKSSHLL-KVNLQRFSDEVCQKRL-RFSIDTRTQFCAGSM 296
            || .|....|. ..:.||||.|..|....::| :..:...|:..||::: .::| |....|.|..
 Frog   872 LPETDQEFSVGINCSIAGWGRTQSGGPVPNILQEAEIPLISNHKCQQQMPEYNI-TDNMVCGGYE 935

  Fly   297 SSQADTCNGDSGGPIFVQHPLYPCLKQ----VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            ....|||.||||||:.       |.:.    ::|:.|:|..|.....|.||.:|..:|:||:|.:
 Frog   936 EGGIDTCQGDSGGPMM-------CQQNNEWFLVGVTSFGYGCAQPSRPGVYVRVTEFTNWIKSFI 993

  Fly   358  357
             Frog   994  993

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 70/262 (27%)
Tryp_SPc 102..353 CDD:214473 68/259 (26%)
tmprss15XP_031752048.1 SEA 36..>103 CDD:396113
LDLa 157..190 CDD:197566
CUB 199..305 CDD:238001
MAM 321..478 CDD:395504
CUB 501..608 CDD:395345
LDLa 620..654 CDD:238060 5/8 (63%)
SR 655..746 CDD:214555 20/100 (20%)
Tryp_SPc 760..991 CDD:238113 70/261 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.