DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and klkb1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_002934450.3 Gene:klkb1 / 100486524 XenbaseID:XB-GENE-985051 Length:629 Species:Xenopus tropicalis


Alignment Length:380 Identity:103/380 - (27%)
Similarity:158/380 - (41%) Gaps:95/380 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CKELTPSDCPVI------FYNQHLIGAEV---KYCDE--FNDIVCCPIPLDHQNLKPAEQTRPFE 83
            || .:||.||:.      |....|:..||   |.|.:  .|:|.|     .....:|. |:...|
 Frog   283 CK-FSPSVCPLTILSDAEFLGDELLVEEVSGEKECQQECTNNIRC-----QFFTYRPM-QSGCSE 340

  Fly    84 KQCKQYNEVRS--------------------ACQ-------STPF-----IVGGTKASGKEFPF- 115
            .:||.:.::.|                    .|:       ..|.     |||||.:...|:|: 
 Frog   341 NKCKCHMKISSNGLPTGIRHGNGEISGFSLRLCKIKSVKGCGEPIEHANRIVGGTDSVLGEWPWQ 405

  Fly   116 ----MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPK-FVVRL 175
                :.|..:::.:.        ||||::..::::|||||.        .:.|   .|: :::..
 Frog   406 VSMHLRLTASYKKHA--------CGGSIISNQWIVTAAHCF--------AMHP---LPQMWIIYS 451

  Fly   176 GELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDS 240
            |.:..::.|......:...:  ::||.|    ...|...||||::|.....||||..|:||||..
 Frog   452 GVVKLSNITQSTPFSETEQI--IIHPHY----TGAGNGTDIALLKLKTPISFNDHQKAICLPPRE 510

  Fly   241 GNDV--QQVTAAGWGFTAD-GVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADT 302
            ...|  ......|||||.: |..::.|.|..:.:.|.|.||.....:...:...|||....:.|:
 Frog   511 PTFVLPNSCWITGWGFTEESGSLANILQKAEVPQISTEECQGNYEQTRIDKKILCAGYKRGKIDS 575

  Fly   303 CNGDSGGPIFVQHPLYPCLKQVI----GIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            |.||||||:       .|:...|    ||.|:|..|...|.|.|||:|..:||||
 Frog   576 CKGDSGGPL-------ACVVDEIWYLTGITSWGEGCARPGKPGVYTRVSEFTDWI 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/265 (30%)
Tryp_SPc 102..353 CDD:214473 78/263 (30%)
klkb1XP_002934450.3 APPLE 21..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519 103/380 (27%)
APPLE 290..373 CDD:128519 17/88 (19%)
Tryp_SPc 391..626 CDD:238113 80/265 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.