DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and hoxc4

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_002936684.1 Gene:hoxc4 / 100486039 XenbaseID:XB-GENE-967141 Length:297 Species:Xenopus tropicalis


Alignment Length:182 Identity:31/182 - (17%)
Similarity:57/182 - (31%) Gaps:62/182 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVH--PGYDTEDEEQGFKNDIALVELDRK 224
            :|.|:..|||               ...:::...||:..  |.|.:...:..|::...|      
 Frog    41 MDSNYIDPKF---------------PPCEEYSQNNYIPEHSPEYYSRSRDPAFQHHQDL------ 84

  Fly   225 AEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRT 289
                       .||.:....:|.:.|  ...|.|..::|      .|...   |.:...::..::
 Frog    85 -----------YPPRTAYPERQFSCA--SIQAPGNPATH------PRLHG---QPQSNHNLVGKS 127

  Fly   290 QFCAGSMSSQADTCNGDSGGPI--------FVQHP---------LYPCLKQV 324
            |.|.....|.|...:..|..|.        ..:||         :||.:|::
 Frog   128 QLCEHPTPSLASNSSSSSPSPAPTACTQAPTSEHPTNTASKQPIVYPWMKKI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 31/182 (17%)
Tryp_SPc 102..353 CDD:214473 31/182 (17%)
hoxc4XP_002936684.1 Homeobox 196..250 CDD:365835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.