DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and pamr1b

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_009296508.1 Gene:pamr1b / 100330319 ZFINID:ZDB-GENE-100422-12 Length:1097 Species:Danio rerio


Alignment Length:277 Identity:72/277 - (25%)
Similarity:123/277 - (44%) Gaps:43/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 KASGKEFPFMALI------------GTHRPNKSKSDINWD--CGGSVVHPKFVLTAAHCLETDES 157
            |....::|::|.|            |.....:.:::..|.  |.|::|:.:.|:.||||: |:..
Zfish   833 KPEQTQWPWLASIYRRPAGKLKLKSGKEDQAEDQAEDGWQLVCSGALVNQRSVVVAAHCV-TELG 896

  Fly   158 KAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELD 222
            |...|||:    ...|.||:...:.......:|..||.:..:||.:|    .....:|:|:::|.
Zfish   897 KTHPLDPH----TLRVTLGKHYRSERRHTKGLQTVRVSSIALHPTFD----PLVLDSDVAVLKLL 953

  Fly   223 RKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGF-----TADGVKS--SHLLKVNLQRFSDEVCQKR 280
            .||...:||..||| ||......|....||..     .|||.::  .|:|..:..:...:.....
Zfish   954 DKARIGEHVVPVCL-PDPQLTADQGLVTGWSLEPDPADADGERARVGHVLMGDTVQCEQQYASHG 1017

  Fly   281 LRFSIDTRTQFCAGSMSSQADTCNGDSGG----PIFVQHPLYPCLKQVIGIVSYGL---VCGSQG 338
            |..|: :....| |..:.:::.|..|:||    |....|.  |....::|:||:|.   ||.|: 
Zfish  1018 LPISV-SENMLC-GRQAERSNICPADTGGILLSPAGSAHT--PQHWTLLGLVSFGFESSVCSSE- 1077

  Fly   339 LPSVYTKVHLYTDWIES 355
            |.:|||.:..:..:||:
Zfish  1078 LYTVYTHIANFVSFIEA 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 72/277 (26%)
Tryp_SPc 102..353 CDD:214473 70/273 (26%)
pamr1bXP_009296508.1 CUB 138..244 CDD:238001
EGF_CA 248..282 CDD:238011
CCP 287..341 CDD:153056
CCP 346..402 CDD:153056
Sushi <686..719 CDD:278512
Tryp_SPc 838..1095 CDD:238113 71/272 (26%)
Tryp_SPc 838..1092 CDD:214473 69/268 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.