DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and tmprss15

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001919639.2 Gene:tmprss15 / 100148042 ZFINID:ZDB-GENE-091204-83 Length:990 Species:Danio rerio


Alignment Length:403 Identity:97/403 - (24%)
Similarity:151/403 - (37%) Gaps:100/403 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ASVSVVTEYCDNGTGECKELTPSDCPVIFYNQHLIGAE---------------VKYCDEFNDIVC 63
            |||....|.|.|||.|      :|| |.....:..|.|               ..:..:|:|..|
Zfish   612 ASVCDGVEDCPNGTDE------ADC-VHVIKDNTTGTERLKLRIQNNLYTVCAQDWTPQFSDFFC 669

  Fly    64 -------------------CPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPF-------- 101
                               .|....:.|...:.:.:|.:| |.....|...|.:.|.        
Zfish   670 RYLGYRSGVALFSITVEGDGPFTTVNVNTNGSLELKPSDK-CISEKIVSLHCNNQPCGVRKVPSK 733

  Fly   102 --------------IVGGTKASGKEFPFMA---LIGTHRPNKSKSDINWDCGGSVVHPKFVLTAA 149
                          :|||..|....:|:|.   .:|.|.           ||.:::..::::|||
Zfish   734 SKIIEETDGKKEGRVVGGQDAQRGAWPWMVSLQWLGGHA-----------CGATLIDREWLITAA 787

  Fly   150 HCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKN 214
            ||:         ...|.....:...|| |.....|.:...|.|.|...::|..|:...:|    :
Zfish   788 HCV---------YGRNVQLSNWAAVLG-LHAQFETINPNKQVFSVDQVIMHKHYNKRTKE----S 838

  Fly   215 DIALVELDRKAEFNDHVAAVCLPPDSG---NDVQQVTAAGWGFTAD-GVKSSHLLKVNLQRFSDE 275
            |.||:.|.....:.|:|..:|| ||.|   .:.::...||||..:: |:|:..|.:..:...|:.
Zfish   839 DFALMHLKTPVSYTDYVQPICL-PDPGAHFEEGRKCFIAGWGLLSESGLKADVLQQAVVPLLSNT 902

  Fly   276 VCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLP 340
            .||:.|.....|....|||......|||.||||||:..:...:..|   :|..|:|:.||....|
Zfish   903 QCQEWLPEYNFTERMMCAGYAEGGVDTCQGDSGGPLMCEEEGHWVL---VGATSFGIGCGRPQRP 964

  Fly   341 SVYTKVHLYTDWI 353
            ..|.:|..:.||:
Zfish   965 GAYARVSQFVDWV 977

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 72/259 (28%)
Tryp_SPc 102..353 CDD:214473 71/257 (28%)
tmprss15XP_001919639.2 SEA 19..>89 CDD:279699
LDLa 142..175 CDD:238060
CUB 183..288 CDD:238001
MAM 302..457 CDD:279023
MAM 302..457 CDD:99706
CUB 477..586 CDD:238001
LDLa 596..630 CDD:238060 9/23 (39%)
SRCR_2 653..728 CDD:295335 11/75 (15%)
Tryp_SPc 747..977 CDD:214473 71/258 (28%)
Tryp_SPc 748..980 CDD:238113 72/259 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.