DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and tmprss12

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_031751504.1 Gene:tmprss12 / 100127698 XenbaseID:XB-GENE-964846 Length:324 Species:Xenopus tropicalis


Alignment Length:271 Identity:84/271 - (30%)
Similarity:120/271 - (44%) Gaps:51/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFP-------FMALIG-THRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESK 158
            ||||..|....:|       |..|.| :||           ||||::...:||:||||.      
 Frog    41 IVGGRNALPGAWPWQVSLQYFRTLSGYSHR-----------CGGSLIQNNWVLSAAHCF------ 88

  Fly   159 AERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDR 223
              |.:.|.:..:.|:.|    :|...:.:.|...::...::|..||    .....|||||:.|..
 Frog    89 --RANRNPEYWRAVLGL----HNIFMEGSPVVKAKIKQIIIHASYD----HIAITNDIALLLLHD 143

  Fly   224 KAEFNDHVAAVCL----PPDSGNDVQQVTA---AGWGFTAD-GVKSSHLLKVNLQRFSDEVCQKR 280
            ...::|::..|||    .|||      :||   .|||.|.: |..|..|.:..:|......|...
 Frog   144 FVTYSDYIHPVCLGSVTVPDS------LTACFITGWGVTKEKGSISVILQEALVQTIPYSECNSS 202

  Fly   281 LRFS-IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYT 344
            ..:: ..|::..|||..|...|:|.|||||| ||.:.........:||.|:|..||....|.|||
 Frog   203 SSYNGFITQSMICAGDNSGAVDSCQGDSGGP-FVCYNTERMRFYQMGITSFGYGCGKPNFPGVYT 266

  Fly   345 KVHLYTDWIES 355
            ||..|..||::
 Frog   267 KVESYVSWIKA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 84/271 (31%)
Tryp_SPc 102..353 CDD:214473 82/267 (31%)
tmprss12XP_031751504.1 Tryp_SPc 41..278 CDD:238113 84/271 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.