DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and LOC100004411

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001343728.4 Gene:LOC100004411 / 100004411 -ID:- Length:494 Species:Danio rerio


Alignment Length:422 Identity:109/422 - (25%)
Similarity:154/422 - (36%) Gaps:130/422 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CDNGTGECKE-------LTP------------SDCPVIFYNQHLIGAEVKYC--DEFNDIVC-C- 64
            |.|| |.|:|       |.|            |||      ::..|..:.||  :|...:.| | 
Zfish    95 CQNG-GMCRENRGVQECLCPPLYSGTNCETEVSDC------KYKNGGCLHYCSQNETAGVECSCA 152

  Fly    65 ---PIPLDHQNLKPAEQTRPFEKQ------CKQYNEV------------------------RSAC 96
               .:..|..:..||.| .|..||      .:..::|                        |||.
Zfish   153 DGYQLDEDRHSCSPAVQ-YPCGKQWTGGIMSRSLDDVSHTHADYANHTHSSTSPSHPLHHNRSAL 216

  Fly    97 QSTPF---------------------------IVGGTKASGKEFPFMALIGTHRPNKSKSDINWD 134
            :::..                           ||||........|:..|:       .:.|....
Zfish   217 ENSTHQNQTELTAPDQLLDTGSDFTGGNEDTRIVGGQLQRQGGSPWQVLL-------RREDEYGF 274

  Fly   135 CGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVV 199
            ||||:::.::|:||||||:             .:|..:. :|  ||:....|...|...|...:.
Zfish   275 CGGSLINQRWVITAAHCLQ-------------QTPHHIT-IG--DYDKMRPDKDEQKITVEKIIP 323

  Fly   200 HPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSG------NDVQQVTAAGWGFTADG 258
            ||.|    .|..|.:||||:.|..........:..|| ||:.      ...:|...:|||.|...
Zfish   324 HPHY----HEYTFDSDIALLYLSSAVTLGPFASPACL-PDANLAERLMKPGEQGLVSGWGSTHYL 383

  Fly   259 VKSSHLL-KVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLK 322
            .:||..| ||.|.....:.|..... .|.|...||||.:..:.|.|.||||||..|.   |....
Zfish   384 QRSSRFLRKVQLPVVEQKSCINSTE-QIITDNMFCAGFLMEEMDACTGDSGGPFIVN---YRGTW 444

  Fly   323 QVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354
            .:.|:||:|..|.|||...|||::..|..||:
Zfish   445 FLTGVVSWGERCASQGKYGVYTRLGNYLSWIQ 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/260 (31%)
Tryp_SPc 102..353 CDD:214473 79/257 (31%)
LOC100004411XP_001343728.4 GLA 22..85 CDD:214503
EGF_CA 86..122 CDD:238011 8/27 (30%)
FXa_inhibition 128..164 CDD:291342 8/41 (20%)
Tryp_SPc 248..475 CDD:214473 79/258 (31%)
Tryp_SPc 249..477 CDD:238113 81/260 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.