DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and tmprss3a

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:379 Identity:98/379 - (25%)
Similarity:155/379 - (40%) Gaps:81/379 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IASVSVVTEYCDNGTGE--CKE-----LTPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCPIPLDH 70
            ::..|.|.:..::|...  |.|     |:.|.|..:.|::.:         |...:....|..|:
Zfish   189 LSGKSSVLQVLNDGVWRTVCAENWNSNLSLSACKQLGYSRFV---------ESKALPLSFIEQDY 244

  Fly    71 QN--LKPAEQTRPFEKQCKQYNEVRS----------------ACQSTP----FIVGGTKASGKEF 113
            ||  :........|::..|.:|...|                ||.|.|    .||||..::..:|
Zfish   245 QNNLISIGLNQTSFQQPVKIHNITNSSKTKCSLGMVTALKCIACGSRPKFSARIVGGNLSAEGQF 309

  Fly   114 PFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKF---VVRL 175
            |:.  :..|..|:..      ||||::..:::||||||:.           ....|.:   ...|
Zfish   310 PWQ--VSLHFQNEHL------CGGSIITSRWILTAAHCVY-----------GIAYPMYWMVYAGL 355

  Fly   176 GELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLP--P 238
            .||..|:      |:.|.|...:.|..|    ..:|..:||||::|.:...||..|..:|||  .
Zfish   356 TELPLNA------VKAFAVEKIIYHSRY----RPKGLDHDIALMKLAQPLTFNGMVEPICLPNFG 410

  Fly   239 DSGNDVQQVTAAGWGFTADGVKSS---HLLKVNLQRFSDEVC-QKRLRFSIDTRTQFCAGSMSSQ 299
            :...|.:....:|||.|.||..:|   |...|.|  .|::.| |..:.....|....|||.:...
Zfish   411 EQFEDGKMCWISGWGATEDGGDASVSQHCASVPL--ISNKACSQPEVYQGYLTAGMICAGYLDGG 473

  Fly   300 ADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            .|:|.||||||:..:.   ..:.:::|..|:|..|..:..|.|||::.....||
Zfish   474 TDSCQGDSGGPLACED---SSIWKLVGATSWGQGCAEKNKPGVYTRITQSLTWI 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 76/261 (29%)
Tryp_SPc 102..353 CDD:214473 74/259 (29%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845 21/109 (19%)
Tryp_SPc 298..525 CDD:238113 76/261 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.