DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmer and SDR42E1

DIOPT Version :9

Sequence 1:NP_611734.1 Gene:Gmer / 37638 FlyBaseID:FBgn0267823 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_660151.2 Gene:SDR42E1 / 93517 HGNCID:29834 Length:393 Species:Homo sapiens


Alignment Length:273 Identity:62/273 - (22%)
Similarity:101/273 - (36%) Gaps:59/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KKVLVTGGTGLVGKALEAVIKE----------QSPEDEQWFFAGSK--DADLTNLAATQALFARE 54
            :.||:|||:|..|..|...:.:          .||  .|....|.|  ..|:.:|:..:..|...
Human     9 ESVLITGGSGYFGFRLGCALNQNGVHVILFDISSP--AQTIPEGIKFIQGDIRHLSDVEKAFQDA 71

  Fly    55 KPTHVIHLAAMVGGLFHNMNNNLDFLRNNLLINDNVLQTAHEQGCVKVV-SCLSTCIFPDKTSYP 118
            ..|.|.|:|:........:|.|| ....|:...||:||....:...::| :.....||..:....
Human    72 DVTCVFHIASYGMSGREQLNRNL-IKEVNVRGTDNILQVCQRRRVPRLVYTSTFNVIFGGQVIRN 135

  Fly   119 IDETM----VHNGPPHPSNYGYSYAKRLIDVQ----NHAYHDK-YGRVYTSVI-PCNIFGP-HDN 172
            .||::    :|..|.|     ||..|.:.:.:    |....|: .|.:.|..: |..|:|| ...
Human   136 GDESLPYLPLHLHPDH-----YSRTKSIAEQKVLEANATPLDRGDGVLRTCALRPAGIYGPGEQR 195

  Fly   173 YNPE-VSHVIPGM-------------------IYRMHQLVTE-----KTDVPENDKVFTVFGSGM 212
            :.|. ||::..|:                   :.:.|.|.:|     |..:......|  ...|.
Human   196 HLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQAHILASEALRADKGHIASGQPYF--ISDGR 258

  Fly   213 PLRQFVYSRDLAE 225
            |:..|.:.|.|.|
Human   259 PVNNFEFFRPLVE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmerNP_611734.1 GDP_FS_SDR_e 3..313 CDD:187550 62/272 (23%)
Epimerase 4..234 CDD:279681 62/271 (23%)
SDR42E1NP_660151.2 3b-HSD_like_1_SDR_e 10..350 CDD:187672 62/272 (23%)
3Beta_HSD 12..283 CDD:279420 61/270 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.