DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmer and GRE2

DIOPT Version :9

Sequence 1:NP_611734.1 Gene:Gmer / 37638 FlyBaseID:FBgn0267823 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_014490.1 Gene:GRE2 / 854014 SGDID:S000005511 Length:342 Species:Saccharomyces cerevisiae


Alignment Length:158 Identity:32/158 - (20%)
Similarity:64/158 - (40%) Gaps:30/158 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 TSVIPCNIFGPHDNYNPEVSHVIPGMIYRMH-----QLVTEKTDVPENDKVFTVFGSGMPLRQFV 218
            |:|.|..:||| ..::.:|         :.|     :||.....:...||:..:||.      ::
Yeast   192 TAVNPVYVFGP-QMFDKDV---------KKHLNTSCELVNSLMHLSPEDKIPELFGG------YI 240

  Fly   219 YSRDLAELMIWVLRNYESV-EPIILSADEVQEVTIFEVAQAVAKAFN-FNGRLVCDTSKSDGQYK 281
            ..||:|:..:...:..|:: :.:|:|.   ...|:.:|...:.:.|. ..|.:......|...:.
Yeast   241 DVRDVAKAHLVAFQKRETIGQRLIVSE---ARFTMQDVLDILNEDFPVLKGNIPVGKPGSGATHN 302

  Fly   282 ---KTASNAKLRSFLPDYAFTDLETAIN 306
               .|..|.|.:..| .:.|.:|:..|:
Yeast   303 TLGATLDNKKSKKLL-GFKFRNLKETID 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmerNP_611734.1 GDP_FS_SDR_e 3..313 CDD:187550 32/158 (20%)
Epimerase 4..234 CDD:279681 17/79 (22%)
GRE2NP_014490.1 AR_SDR_e 3..318 CDD:187538 29/145 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345643
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.