DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmer and AT1G66800

DIOPT Version :10

Sequence 1:NP_611734.1 Gene:Gmer / 37638 FlyBaseID:FBgn0267823 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_176852.2 Gene:AT1G66800 / 842998 AraportID:AT1G66800 Length:319 Species:Arabidopsis thaliana


Alignment Length:195 Identity:38/195 - (19%)
Similarity:67/195 - (34%) Gaps:60/195 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 LQSTVIELELDSEDYKLLIILPDYEFGLGNVLKLLQIGDNVPSL----------------REVTE 478
            ||:..|.:.:|.|:.:        ..||.|:.|.:|  |:..||                .|..:
plant    43 LQNKNINVFIDEEEVR--------GKGLKNLFKRIQ--DSKISLAIFSESKCDFNDLLKNNESAD 97

  Fly   479 QMSPTWVKTIV--PKFNLKGNIILTSDLQNLGIND-----------IFEPSRADFS-LMTEDPTI 529
            :..|.:.|...  ...:|:.::....||.|..:.:           ::....|:.. .|.....:
plant    98 EAIPIFYKVDATGDLADLQNSVKCKKDLINSAVEEMSKLLANISVGVYREKEANSKCFMVPARKL 162

  Fly   530 YAKHIEQSINVNIRTHSLQQLKRFTSLYKNPVELAVNYPFLFCILDNELDLALMIG----RILNP 590
            ...|.|:.||..           ::|:|:.|.:.|:....|     ||:....|.|    |.|.|
plant   163 QMSHSEKLINWT-----------WSSIYETPNDAAIEVAML-----NEVHWLHMSGNFHTRNLTP 211

  Fly   591  590
            plant   212  211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmerNP_611734.1 GDP_FS_SDR_e 3..313 CDD:187550
AT1G66800NP_176852.2 Rossmann-fold NAD(P)(+)-binding proteins 3..315 CDD:473865 38/195 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.