DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmer and AT2G23910

DIOPT Version :10

Sequence 1:NP_611734.1 Gene:Gmer / 37638 FlyBaseID:FBgn0267823 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_565557.1 Gene:AT2G23910 / 816923 AraportID:AT2G23910 Length:304 Species:Arabidopsis thaliana


Alignment Length:51 Identity:11/51 - (21%)
Similarity:19/51 - (37%) Gaps:20/51 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KVVSCLSTCIFPDKTSYPIDETMVHNGPPHPSNYGYSYAKRLIDVQNHAYH 151
            |.:||   |...|.::|                .|:...|||: .:.::.|
plant     5 KTISC---CCVLDASTY----------------VGFWILKRLL-TRGYSVH 35

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmerNP_611734.1 GDP_FS_SDR_e 3..313 CDD:187550 11/51 (22%)
AT2G23910NP_565557.1 PLN02583 2..302 CDD:178195 11/51 (22%)

Return to query results.
Submit another query.