DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmer and HSD3B7

DIOPT Version :9

Sequence 1:NP_611734.1 Gene:Gmer / 37638 FlyBaseID:FBgn0267823 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_079469.2 Gene:HSD3B7 / 80270 HGNCID:18324 Length:369 Species:Homo sapiens


Alignment Length:412 Identity:80/412 - (19%)
Similarity:128/412 - (31%) Gaps:169/412 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVTGGTGLVGKALEAVIKEQSPE-------DEQ---WF--------FAGSKDADLTNLAATQALF 51
            |||||.|.:|:.:..::.::.|.       |:.   |.        ...:...|:|......|..
Human    13 LVTGGCGFLGEHVVRMLLQREPRLGELRVFDQHLGPWLEELKTGPVRVTAIQGDVTQAHEVAAAV 77

  Fly    52 AREKPTH-VIHLAAMVGGLFHNMNNNLDFLRNNLLINDNVLQTAHE---QGCVKVV-SCLST--- 108
            |   ..| |||.|.:| .:|...:.                :|.||   ||...|: :|:.|   
Human    78 A---GAHVVIHTAGLV-DVFGRASP----------------KTIHEVNVQGTRNVIEACVQTGTR 122

  Fly   109 ---------CIFPDKTSYPI----DET---MVHNGPPHPSNYGYSYAKRLIDVQNHAYHDKYGR- 156
                     .:.|:...:|.    ::|   .||.   ||.....:.|:.|:...|       || 
Human   123 FLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR---HPYPCSKALAEWLVLEAN-------GRK 177

  Fly   157 -------VYTSVIPCNIFGP-----HDNYN--------------PEVSH--VIPGMIYRMHQLVT 193
                   |..::.|..|:|.     .|.|.              ..|.|  |..|.:..||.|..
Human   178 VRGGLPLVTCALRPTGIYGEGHQIMRDFYRQGLRLGGWLFRAIPASVEHGRVYVGNVAWMHVLAA 242

  Fly   194 EKTDVPENDKVFTVFG-------SGMPLRQF---------------------------VYSRDLA 224
            .     |.::..|:.|       .|.|.|.:                           |:...|.
Human   243 R-----ELEQRATLMGGQVYFCYDGSPYRSYEDFNMEFLGPCGLRLVGARPLLPYWLLVFLAALN 302

  Fly   225 ELMIWVLRNYESVEPIILSADEVQEVTIFEVAQAVAKAFNFNGRLVCDTSKSDGQYKKTASNAKL 289
            .|:.|:||      |::|.|..:...|:     |||     |......|.|:...:         
Human   303 ALLQWLLR------PLVLYAPLLNPYTL-----AVA-----NTTFTVSTDKAQRHF--------- 342

  Fly   290 RSFLPDYAFTDLETAINASVKW 311
             .:.|.:::.|..|   .::.|
Human   343 -GYEPLFSWEDSRT---RTILW 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmerNP_611734.1 GDP_FS_SDR_e 3..313 CDD:187550 80/412 (19%)
Epimerase 4..234 CDD:279681 66/333 (20%)
HSD3B7NP_079469.2 3b-HSD_HSDB1_like_SDR_e 11..361 CDD:187671 80/412 (19%)
3Beta_HSD 13..291 CDD:279420 60/312 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.