DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmer and NSDHL

DIOPT Version :9

Sequence 1:NP_611734.1 Gene:Gmer / 37638 FlyBaseID:FBgn0267823 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_016885053.1 Gene:NSDHL / 50814 HGNCID:13398 Length:389 Species:Homo sapiens


Alignment Length:271 Identity:61/271 - (22%)
Similarity:99/271 - (36%) Gaps:79/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KKVLVTGGTGLVGK-----------ALEAVIKEQSPEDEQ-WFFAGSKDADLTNLAATQALFARE 54
            |:..|.||:|.:|:           |:.....:|..::.| .||.|       :|.:.|.|:...
Human    54 KRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLG-------DLCSRQDLYPAL 111

  Fly    55 KPTHVIHLAAMVGGLFH------NMNNNLDFLRNNLLINDNVLQTAHEQGCVKVVSCLSTCIFPD 113
            |..:.:         ||      :.||...|.|.|.:...||::|..|.|..|::...|..:.  
Human   112 KGVNTV---------FHCASPPPSSNNKELFYRVNYIGTKNVIETCKEAGVQKLILTSSASVI-- 165

  Fly   114 KTSYPIDETMVHNGP---PH---PSNYGYSYAKRLIDVQNHAYHDKYGRVYTSVI-PCNIFGPHD 171
                 .:...:.||.   |:   |.:| |:..|.|.:......:|......|:.| |..||||.|
Human   166 -----FEGVDIKNGTEDLPYAMKPIDY-YTETKILQERAVLGANDPEKNFLTTAIRPHGIFGPRD 224

  Fly   172 NYNPEVSHVIPGMIYRMHQLVTEKTDVPENDKVFTVFGSGMPLRQFVYSRDLAELMIWVLRNYES 236
                             .|||....:...|.|:..|.|:|..|..|.:..::             
Human   225 -----------------PQLVPILIEAARNGKMKFVIGNGKNLVDFTFVENV------------- 259

  Fly   237 VEPIILSADEV 247
            |...||:|:::
Human   260 VHGHILAAEQL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmerNP_611734.1 GDP_FS_SDR_e 3..313 CDD:187550 60/270 (22%)
Epimerase 4..234 CDD:279681 56/254 (22%)
NSDHLXP_016885053.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.