DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmer and CG5955

DIOPT Version :9

Sequence 1:NP_611734.1 Gene:Gmer / 37638 FlyBaseID:FBgn0267823 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_649230.1 Gene:CG5955 / 40268 FlyBaseID:FBgn0036997 Length:367 Species:Drosophila melanogaster


Alignment Length:334 Identity:62/334 - (18%)
Similarity:103/334 - (30%) Gaps:119/334 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVLVTGGTGLVG---------------KALEAVIKEQSP--EDEQWFFAGSKDADLTNLAATQAL 50
            |:|:|||.|.:|               ..|..:||....  |:..:.|     ||:.:....|.:
  Fly    47 KILITGGLGQLGIECAKLLRTQYGSQNVILSDIIKPSQSVLENGPYIF-----ADILDFKGLQKI 106

  Fly    51 FAREKPTHVIHLAAMVGGLFHNMNNNLDF-LRNNLLINDNVLQTAHEQGCVKVVSCLSTCIFPDK 114
            ....:...:||.:|::..:   ...|:.. :|.|:....||::.|.:.                |
  Fly   107 VVDHRIDWLIHFSALLSAV---GEQNVPLAVRVNIEGVHNVIELAKQY----------------K 152

  Fly   115 TSYPIDETMVHNGPPHPSN-------------YGYSYAKRLIDVQNHAYHDKYGRVYTSVIPCNI 166
            ....:..|:...||..|.|             ||.|  |...::....|:.|:|..:.    |..
  Fly   153 LRIFVPSTIGAFGPDSPRNPTPNVTIQRPRTIYGVS--KVHAELIGEYYYHKFGLDFR----CLR 211

  Fly   167 FGPHDNYNPEVSHVIPGMIYRMHQLVTEKTDVP---ENDKVFTVFGSGMPLRQFV-YSRDLAELM 227
            |              ||:|         .:|.|   ..|....||...:...::. |.|....| 
  Fly   212 F--------------PGVI---------SSDPPGGGTTDYAVAVFHEALRNGKYTCYLRPDTRL- 252

  Fly   228 IWVLRNYESVEPIILSADEVQEVTIFEVAQAVAKAFNFNGRLVCDTSKSDGQYKKTASNAKLRSF 292
                       |::...|.::.:..|..|                   .:.|.|:...|....||
  Fly   253 -----------PMMYIEDCLRALLEFMRA-------------------PNEQLKRRVYNVTAMSF 287

  Fly   293 LPDYAFTDL 301
            .|:..|..|
  Fly   288 TPEELFAQL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmerNP_611734.1 GDP_FS_SDR_e 3..313 CDD:187550 62/334 (19%)
Epimerase 4..234 CDD:279681 49/264 (19%)
CG5955NP_649230.1 WcaG 47..355 CDD:223528 62/334 (19%)
TDH_SDR_e 47..351 CDD:187580 62/334 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466367
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.