DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmer and gfus

DIOPT Version :9

Sequence 1:NP_611734.1 Gene:Gmer / 37638 FlyBaseID:FBgn0267823 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001032328.1 Gene:gfus / 394680 XenbaseID:XB-GENE-5754213 Length:317 Species:Xenopus tropicalis


Alignment Length:321 Identity:192/321 - (59%)
Similarity:246/321 - (76%) Gaps:8/321 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KKVLVTGGTGLVGKALEAVIKE-QSPEDEQWFFAGSKDADLTNLAATQALFAREKPTHVIHLAAM 65
            |::|||||:||||||:|.|:.: :...||||.|..|||||||:.|.|:|||.:.|||||||||||
 Frog     4 KRILVTGGSGLVGKAIEKVVADGEGRPDEQWIFVASKDADLTSAADTKALFEKHKPTHVIHLAAM 68

  Fly    66 VGGLFHNMNNNLDFLRNNLLINDNVLQTAHEQGCVKVVSCLSTCIFPDKTSYPIDETMVHNGPPH 130
            |||||.||..|||||||||.||||||.:|:|.|..|||||||||||||||:|||||||:|:||||
 Frog    69 VGGLFRNMKYNLDFLRNNLHINDNVLHSAYELGVHKVVSCLSTCIFPDKTTYPIDETMIHSGPPH 133

  Fly   131 PSNYGYSYAKRLIDVQNHAYHDKYGRVYTSVIPCNIFGPHDNYNPEVSHVIPGMIYRMHQLVTEK 195
            .||:|||||||:|||||.||::::|..:|||||.|:||||||:|.|..||:||:|::::....:.
 Frog   134 TSNFGYSYAKRMIDVQNRAYYEQHGCQFTSVIPTNVFGPHDNFNIEDGHVLPGLIHKVYSAKQDG 198

  Fly   196 TDVPENDKVFTVFGSGMPLRQFVYSRDLAELMIWVLRNYESVEPIILSADEVQEVTIFEVAQAVA 260
            |.:       :::|:|.|.|||:||.|||.|.|||||.|..|:|||||..|..||:|.|.|:::.
 Frog   199 TPL-------SIWGTGKPRRQFIYSLDLARLFIWVLREYNEVDPIILSVGEEDEVSIKEAAESIV 256

  Fly   261 KAFNFNGRLVCDTSKSDGQYKKTASNAKLRSFLPDYAFTDLETAINASVKWYIENYDQARK 321
            .|.:|.|.::.|::|||||:||||||:|||.:|||:.||....|:..:..|:..||.||||
 Frog   257 AAMDFKGEVIFDSTKSDGQFKKTASNSKLRRYLPDFQFTPFSKAVQETCDWFNSNYAQARK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmerNP_611734.1 GDP_FS_SDR_e 3..313 CDD:187550 185/310 (60%)
Epimerase 4..234 CDD:279681 147/230 (64%)
gfusNP_001032328.1 GDP_FS_SDR_e 5..308 CDD:187550 184/309 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 312 1.000 Domainoid score I1298
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 402 1.000 Inparanoid score I1872
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003311
OrthoInspector 1 1.000 - - oto104142
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2209
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.