DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmer and F08F3.10

DIOPT Version :10

Sequence 1:NP_611734.1 Gene:Gmer / 37638 FlyBaseID:FBgn0267823 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_872219.2 Gene:F08F3.10 / 353440 WormBaseID:WBGene00017266 Length:208 Species:Caenorhabditis elegans


Alignment Length:83 Identity:19/83 - (22%)
Similarity:37/83 - (44%) Gaps:6/83 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TGLVGKALEAVIKEQSPEDEQWF-----FAGSKDAD-LTNLAATQALFAREKPTHVIHLAAMVGG 68
            |.::|..|..::..::...|:.|     ||..:.|| :....|.:..|......|.:||.:::..
 Worm    45 TSIIGITLGVLLLVKTEWHEKLFIYKLTFAYIRRADPVRYWIAYRIFFGFWISLHSLHLLSIIST 109

  Fly    69 LFHNMNNNLDFLRNNLLI 86
            :.....:||..|:..||:
 Worm   110 VVAVHKSNLKLLKPQLLV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmerNP_611734.1 GDP_FS_SDR_e 3..313 CDD:187550 19/83 (23%)
F08F3.10NP_872219.2 None

Return to query results.
Submit another query.