DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmer and Uxs1

DIOPT Version :9

Sequence 1:NP_611734.1 Gene:Gmer / 37638 FlyBaseID:FBgn0267823 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_038938945.1 Gene:Uxs1 / 246232 RGDID:628680 Length:459 Species:Rattus norvegicus


Alignment Length:331 Identity:75/331 - (22%)
Similarity:125/331 - (37%) Gaps:48/331 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KKVLVTGGTGLVGKAL---------EAVIKE-----QSPEDEQWFFAGSKDADLTNLAATQALFA 52
            |::|:|||.|.||..|         |..:.:     :....|.|.  |.::.:|.|....:.|:.
  Rat   128 KRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWI--GHENFELINHDVVEPLYI 190

  Fly    53 REKPTHVIHLAAMVGGLFHNMNNNLDFLRNNLLINDNVLQTAHEQGCVKVVSCLSTCIFPDKTSY 117
              :...:.|||:..... :.|.|.:..|:.|.:...|:|..|...|...:::..|. ::.|...:
  Rat   191 --EVDQIYHLASPASPP-NYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSE-VYGDPEVH 251

  Fly   118 PIDETMVHNGPPHPSNYGYSYAKRLIDVQNHAYHDKYG------RVYTSVIPCNIFGPHDNYNPE 176
            |..|....:..|......|...||:.:...:||..:.|      |::      |.|||..:.|. 
  Rat   252 PQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIF------NTFGPRMHMND- 309

  Fly   177 VSHVIPGMIYRMHQLVTEKTDVPENDKVFTVFGSGMPLRQFVYSRDLAELMIWVLRNYESVEPII 241
             ..|:...|.:..|           .:..||:|||...|.|.|..||...:: .|.|.....|:.
  Rat   310 -GRVVSNFILQALQ-----------GEPLTVYGSGSQTRAFQYVSDLVNGLV-ALMNSNVSSPVN 361

  Fly   242 LSADEVQEVTIFEVAQAVAKAFNFNGRLVCDTSKSDGQYKKTASNAKLRSFLPDYAFTDLETAIN 306
            |...|  |.||.|.||.:.........:...:...|...|:.....|.:..|.......||..:|
  Rat   362 LGNPE--EHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLN 424

  Fly   307 ASVKWY 312
            .::.::
  Rat   425 KAIHYF 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmerNP_611734.1 GDP_FS_SDR_e 3..313 CDD:187550 74/330 (22%)
Epimerase 4..234 CDD:279681 57/249 (23%)
Uxs1XP_038938945.1 UXS1_N <64..117 CDD:403108
UGD_SDR_e 128..431 CDD:187541 75/331 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.