DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmer and hsd-2

DIOPT Version :9

Sequence 1:NP_611734.1 Gene:Gmer / 37638 FlyBaseID:FBgn0267823 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_508851.1 Gene:hsd-2 / 191049 WormBaseID:WBGene00022498 Length:374 Species:Caenorhabditis elegans


Alignment Length:227 Identity:47/227 - (20%)
Similarity:84/227 - (37%) Gaps:69/227 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKVLVTGGTGLVG----KALE-------AVIKEQSPEDEQWFFAGSKDADLTNLAATQALFARE 54
            |...::.||.|.:|    .||:       .::.:..|::    |...| .|.:|::..:|.|..:
 Worm     1 MGHYVIVGGGGFLGAHVISALQKIGCKERIIVVDPCPQE----FKTIK-IDKSNISYIKASFLDD 60

  Fly    55 K--------PTHVIHLAAMVG--GLF-------HNMNNNLDFLRNNLLINDNVLQTAHEQGCVKV 102
            |        .:.|:|||| ||  ||.       ||.|.|         ....:::.....|..:.
 Worm    61 KVLENILNGASAVVHLAA-VGHTGLIAGDRKSVHNFNVN---------GTKQLIKQCKALGVKRF 115

  Fly   103 VSCLSTCIFPDKTSY---PIDETMVHNGPPHPSNYGYSYAKRLIDVQNHAYHDKYGRVYTSVIP- 163
            :...|..:     |:   |:|.....:..|.|..|...|:....:.:.:        |.:...| 
 Worm   116 LYASSVAV-----SFIGEPLDNVTEDDPLPDPKKYLDFYSASKAEAETY--------VLSQSTPD 167

  Fly   164 ----C----NIFGPHD-NYNPEVSHVIPGMIY 186
                |    .|:||.| |...:|:::|...::
 Worm   168 FKTVCLRFRGIYGPEDPNVTLKVANLIKNGLF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmerNP_611734.1 GDP_FS_SDR_e 3..313 CDD:187550 46/225 (20%)
Epimerase 4..234 CDD:279681 46/224 (21%)
hsd-2NP_508851.1 NADB_Rossmann 5..327 CDD:389744 46/223 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.