Sequence 1: | NP_611734.1 | Gene: | Gmer / 37638 | FlyBaseID: | FBgn0267823 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001346670.1 | Gene: | Hsd3b2 / 15493 | MGIID: | 96234 | Length: | 373 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 51/207 - (24%) |
---|---|---|---|
Similarity: | 85/207 - (41%) | Gaps: | 41/207 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 LVTGGTGLVG-KALEAVIKEQS------------PEDEQWFFAGSKDADLT----NLAATQAL-F 51
Fly 52 AREKPTHVIHLAAM--VGGLFHNMNNNLDFLRNNLLINDNVLQTAHEQGCVKVVSCLSTCIFPDK 114
Fly 115 TSYPIDETMVHNGPP---HPSNYG--YSYAKRLID----VQNHAYHDKYGRVYTSVI-PCNIFGP 169
Fly 170 HDNYNPEVSHVI 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gmer | NP_611734.1 | GDP_FS_SDR_e | 3..313 | CDD:187550 | 51/207 (25%) |
Epimerase | 4..234 | CDD:279681 | 51/207 (25%) | ||
Hsd3b2 | NP_001346670.1 | SDR | 5..357 | CDD:330230 | 51/207 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0451 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |