DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gmer and Hsd3b1

DIOPT Version :9

Sequence 1:NP_611734.1 Gene:Gmer / 37638 FlyBaseID:FBgn0267823 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001291729.1 Gene:Hsd3b1 / 15492 MGIID:96233 Length:373 Species:Mus musculus


Alignment Length:196 Identity:44/196 - (22%)
Similarity:75/196 - (38%) Gaps:42/196 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVTGGTGLVG----------------KALEAVIKEQSPEDEQWFFAGSK----DADLTNLAATQA 49
            ||||..|.||                :||:.|.:.::.|:.......:|    :.|:.:....:.
Mouse     7 LVTGAGGFVGQRIIKMLVQEKELQEVRALDKVFRPETKEEFSKLQTKTKVTVLEGDILDAQCLRR 71

  Fly    50 LFAREKPTHVIHLAAM--VGGLFHNMNNNLDFLRNNLLINDNVLQTAHEQGCVKVVSCLSTCIFP 112
              |.:..:.|||.||:  |.|:.....    .|..||....|:|:...:......:.|.|..: .
Mouse    72 --ACQGISVVIHTAAVIDVTGVIPRQT----ILDVNLKGTQNLLEACVQASVPAFIFCSSVDV-A 129

  Fly   113 DKTSYPIDETMVHNG---PPHPSNYG--YSYAKRLID----VQNHAYHDKYGRVYTSVI-PCNIF 167
            ...||   :.:|.||   ..|.|.:.  |.|:|::.:    ..|.:.....|.:.|..: |..|:
Mouse   130 GPNSY---KKIVLNGHEEQNHESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLNTCALRPMYIY 191

  Fly   168 G 168
            |
Mouse   192 G 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GmerNP_611734.1 GDP_FS_SDR_e 3..313 CDD:187550 44/196 (22%)
Epimerase 4..234 CDD:279681 44/196 (22%)
Hsd3b1NP_001291729.1 NADB_Rossmann 5..357 CDD:389744 44/196 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0451
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.