DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asrij and ociad1

DIOPT Version :9

Sequence 1:NP_001261143.1 Gene:asrij / 37637 FlyBaseID:FBgn0034793 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001039167.1 Gene:ociad1 / 733998 XenbaseID:XB-GENE-985483 Length:254 Species:Xenopus tropicalis


Alignment Length:292 Identity:88/292 - (30%)
Similarity:120/292 - (41%) Gaps:77/292 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SPLNDGSHHPPPHAPH-----PLADYQFSAEEVKALRECNTESFFQRSLPFGTGLGLLAYFGVKN 62
            ||........|  |||     |...|..:.:|.:..||||.|||:.||||......::....:..
 Frog     4 SPAEFSDQQQP--APHRTVQPPGVGYIPTDDERRVFRECNEESFWYRSLPISAVSMIVTQGLISR 66

  Fly    63 GYLQGHVKYGAVPKVVMGVILGYFVGKFSYQQKCAEKIMRLPNSHLGELLRQRRQ--------GG 119
            |.|....::|::|||....:.||..||.||.:.|.||..||.||.|||.|||..:        |.
 Frog    67 GILTTSSRFGSLPKVAFAGLCGYLAGKVSYMKTCQEKFKRLENSPLGEALRQGYRNIPTQYPSGT 131

  Fly   120 GVISSITPDENLGRAFTLAPFSPSSADVYSDEAYQPGR----------------STSLNLDTESR 168
            ...|.:.|.            :.|.||.::....:|..                ||||.   ||.
 Frog   132 SEFSDVNPK------------TASPADGFASNVVEPPSSVYSSHHNSTSDTVPFSTSLG---ESS 181

  Fly   169 PTLSGLDDIYRPTLDSAGSMLEAELPLEPSKPGQSYEDLRRRNREEYSKHQQSPYSRPYEPPVAV 233
            |  ||:.|...|   ...::||.    .|.:...:|::||.||||.|.              :||
 Frog   182 P--SGISDNIAP---EPAALLED----TPKRKPMTYDELRSRNRETYE--------------MAV 223

  Fly   234 QQR---PVEQAQSEPAGRK----NQYGDSWTD 258
            .||   || ::..:.|.||    |:|||.|.:
 Frog   224 TQRADAPV-RSSLDRAARKDVKTNKYGDVWEE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asrijNP_001261143.1 OCIA 21..109 CDD:284466 32/87 (37%)
ociad1NP_001039167.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 7/25 (28%)
OCIA 11..113 CDD:284466 37/103 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..254 43/168 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9947
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9866
Inparanoid 1 1.050 95 1.000 Inparanoid score I4920
OMA 1 1.010 - - QHG50081
OrthoDB 1 1.010 - - D1322104at2759
OrthoFinder 1 1.000 - - FOG0002865
OrthoInspector 1 1.000 - - otm48063
Panther 1 1.100 - - LDO PTHR13336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4700
SonicParanoid 1 1.000 - - X4324
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.