DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asrij and OCIAD1

DIOPT Version :9

Sequence 1:NP_001261143.1 Gene:asrij / 37637 FlyBaseID:FBgn0034793 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_024309873.1 Gene:OCIAD1 / 54940 HGNCID:16074 Length:260 Species:Homo sapiens


Alignment Length:254 Identity:81/254 - (31%)
Similarity:123/254 - (48%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PPHAPHPLADYQFSAEEVKALRECNTESFFQRSLPFGTGLGLLAYFGVKNGYLQGHVKYGAVPKV 77
            |...||...||..:.||.:...|||.|||:.||:|......|:....:..|.|..|.|||::||:
Human    30 PRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKL 94

  Fly    78 VMGVILGYFVGKFSYQQKCAEKIMRLPNSHLGELLRQ---RRQG--GGVISSITPDENLGRAFTL 137
            ::..|:|||.||.||.:.|.||..:|.||.|||.||.   ||..  |........|.::....:.
Human    95 ILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSF 159

  Fly   138 APFSPSSADVYSDEAYQP-GRSTSLNLDTESRPTLSGLDD--IYRPTLDSAGSMLEAELPLEPSK 199
            .. ||::.::.....|:| ..|:|:|   ||.||  |:.|  :..|         :..|...|.:
Human   160 VT-SPAADNIEMLPHYEPIPFSSSMN---ESAPT--GITDHIVQGP---------DPNLEESPKR 209

  Fly   200 PGQSYEDLRRRNREEYSKHQQSPYSRPYEPPVAVQQRPVEQAQSEPAGRKNQYGDSWTD 258
            ...:||:||.:|||.|    :...::..:|.|    ||:.:...:...:.|:|||:|.:
Human   210 KNITYEELRNKNRESY----EVSLTQKTDPSV----RPMHERVPKKEVKVNKYGDTWDE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asrijNP_001261143.1 OCIA 21..109 CDD:284466 36/87 (41%)
OCIAD1XP_024309873.1 OCIA 39..124 CDD:311170 35/84 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155362
Domainoid 1 1.000 77 1.000 Domainoid score I8879
eggNOG 1 0.900 - - E1_29X0K
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9866
Inparanoid 1 1.050 109 1.000 Inparanoid score I4908
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50081
OrthoDB 1 1.010 - - D1322104at2759
OrthoFinder 1 1.000 - - FOG0002865
OrthoInspector 1 1.000 - - oto89256
orthoMCL 1 0.900 - - OOG6_108490
Panther 1 1.100 - - LDO PTHR13336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4700
SonicParanoid 1 1.000 - - X4324
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.