DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asrij and Ociad2

DIOPT Version :9

Sequence 1:NP_001261143.1 Gene:asrij / 37637 FlyBaseID:FBgn0034793 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_081226.1 Gene:Ociad2 / 433904 MGIID:1916377 Length:154 Species:Mus musculus


Alignment Length:111 Identity:38/111 - (34%)
Similarity:56/111 - (50%) Gaps:14/111 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSPLNDGSHHPPPHAPHPLADYQF-----------SAEEVKALRECNTESFFQRSLPFGTGLGL 54
            |.|....|:....||.| ||:....           ..|..|.:|||..|||::|:|||.. :.:
Mouse     1 MASVSTHGNQEKSPHLP-PLSKQSLLFCPKSKLHIHRGEIAKIIRECQEESFWKRALPFSL-ISM 63

  Fly    55 LAYFG-VKNGYLQGHVKYGAVPKVVMGVILGYFVGKFSYQQKCAEK 99
            |...| |..|||..:.::|::|||.:..:||:.:||.||.:.|..|
Mouse    64 LVTQGLVHQGYLAANPRFGSLPKVALAGLLGFGLGKASYIRVCQSK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asrijNP_001261143.1 OCIA 21..109 CDD:284466 30/91 (33%)
Ociad2NP_081226.1 OCIA 33..117 CDD:369184 30/78 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845825
Domainoid 1 1.000 69 1.000 Domainoid score I9586
eggNOG 1 0.900 - - E1_29X0K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002865
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4700
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.