DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asrij and OCIAD2

DIOPT Version :9

Sequence 1:NP_001261143.1 Gene:asrij / 37637 FlyBaseID:FBgn0034793 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001014446.1 Gene:OCIAD2 / 132299 HGNCID:28685 Length:154 Species:Homo sapiens


Alignment Length:96 Identity:34/96 - (35%)
Similarity:51/96 - (53%) Gaps:5/96 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SHHPPPHAPH----PLADYQFSAEEV-KALRECNTESFFQRSLPFGTGLGLLAYFGVKNGYLQGH 68
            :|.|||....    |.:.......|: |.:|||..|||::|:|||.....|:....|..|||..:
Human    14 AHFPPPSKQSLLFCPKSKLHIHRAEISKIMRECQEESFWKRALPFSLVSMLVTQGLVYQGYLAAN 78

  Fly    69 VKYGAVPKVVMGVILGYFVGKFSYQQKCAEK 99
            .::|::|||.:..:||:.:||.||...|..|
Human    79 SRFGSLPKVALAGLLGFGLGKVSYIGVCQSK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asrijNP_001261143.1 OCIA 21..109 CDD:284466 29/80 (36%)
OCIAD2NP_001014446.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 4/7 (57%)
OCIA 15..119 CDD:284466 34/95 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155361
Domainoid 1 1.000 77 1.000 Domainoid score I8879
eggNOG 1 0.900 - - E1_29X0K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322104at2759
OrthoFinder 1 1.000 - - FOG0002865
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13336
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4700
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.