DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment asrij and Ociad2

DIOPT Version :9

Sequence 1:NP_001261143.1 Gene:asrij / 37637 FlyBaseID:FBgn0034793 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_038947481.1 Gene:Ociad2 / 100361733 RGDID:2319541 Length:158 Species:Rattus norvegicus


Alignment Length:138 Identity:46/138 - (33%)
Similarity:66/138 - (47%) Gaps:27/138 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SHHPPPHAPHPLADYQFS------AEEVKALRECNTESFFQRSLPFGTGLGLLAYFG-VKNGYLQ 66
            |||.||.:...|.....|      .|..|.:|||..|||::|:|||.. :.:|...| |..|||.
  Rat    13 SHHLPPLSKQSLLFCPKSKLHIHRGEIAKIIRECQEESFWKRALPFSL-ISMLVTQGLVHQGYLA 76

  Fly    67 GHVKYGAVPKVVMGVILGYFVGKFSYQQKCAEKIMRLPNSHLGELLRQRRQGGGVISSITPDEN- 130
            .:.::|::|||.:..:||:.:||.||.:.|..|.      |..|   .:.:|.|    ..|:.| 
  Rat    77 ANPRFGSLPKVALAGLLGFGLGKASYIRVCQSKF------HSFE---DQLRGAG----FGPEHNR 128

  Fly   131 -----LGR 133
                 |||
  Rat   129 MLLSLLGR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
asrijNP_001261143.1 OCIA 21..109 CDD:284466 32/94 (34%)
Ociad2XP_038947481.1 OCIA 33..117 CDD:399793 32/93 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349244
Domainoid 1 1.000 69 1.000 Domainoid score I9397
eggNOG 1 0.900 - - E1_29X0K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322104at2759
OrthoFinder 1 1.000 - - FOG0002865
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13336
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.810

Return to query results.
Submit another query.