DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YME1L and Bcs1l

DIOPT Version :9

Sequence 1:NP_001246473.1 Gene:YME1L / 37636 FlyBaseID:FBgn0034792 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001292581.1 Gene:Bcs1l / 66821 MGIID:1914071 Length:418 Species:Mus musculus


Alignment Length:165 Identity:47/165 - (28%)
Similarity:80/165 - (48%) Gaps:16/165 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 AKQELKEVVEFLKSPEKFSNLGGKLPKGVLLVGPPGTGKTLLARAVAGEAK--VPFFHAAGPEFD 374
            |.:.:|::.||:.:|:.:.:.|....:|.||.||||.||:....|:|||.:  :...........
Mouse   198 ADRIVKDIREFIDNPKWYIDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDSSLS 262

  Fly   375 EVLVGQGARRVRDLFKAAKARAPCVIFIDEIDSVGAKRTNSVLHPYANQ-----TINQLLSEMDG 434
            :       .|:..|...|..::  ::.::::|:....|..:|.:|...|     |.:.||:.:||
Mouse   263 D-------DRLNHLLSVAPQQS--LVLLEDVDAAFLSRDLAVENPIKYQGLGRLTFSGLLNALDG 318

  Fly   435 FHQNAGVIVLGATNRRDDLDQALLRPGRFDVEVMV 469
            .......||...||..|.||.||:||||.|::..|
Mouse   319 VASTEARIVFMTTNYIDRLDPALIRPGRVDLKEYV 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YME1LNP_001246473.1 FtsH_fam 254..736 CDD:273520 47/165 (28%)
Bcs1lNP_001292581.1 BCS1_N 24..191 CDD:214980
AAA 223..354 CDD:214640 41/140 (29%)
AAA 226..355 CDD:278434 40/137 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.