DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YME1L and bcs1l

DIOPT Version :9

Sequence 1:NP_001246473.1 Gene:YME1L / 37636 FlyBaseID:FBgn0034792 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001016865.1 Gene:bcs1l / 549619 XenbaseID:XB-GENE-1015027 Length:419 Species:Xenopus tropicalis


Alignment Length:216 Identity:58/216 - (26%)
Similarity:99/216 - (45%) Gaps:39/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 EDVKGCDEAKQELKEVVEFLKSPEKFSNLGGKLPKGVLLVGPPGTGKTLLARAVAGEAKVPFFHA 368
            :||||             |:.:|:.:|:.|....:|.||.||||.||:....|:|||.       
 Frog   203 QDVKG-------------FIDNPKWYSDRGIPYRRGYLLYGPPGCGKSSFITALAGEL------- 247

  Fly   369 AGPEFDEVL--VGQGA---RRVRDLFKAAKARAPCVIFIDEIDSVGAKRTNSVLHPYANQ----- 423
               |:...|  :..|:   .|:..|...|..::  :|.::::|:....|..:..:|.|.|     
 Frog   248 ---EYSICLMSLSDGSLSDDRLNHLLSVAPQQS--IILLEDVDAAFVSRDLTKENPTAYQGMGRL 307

  Fly   424 TINQLLSEMDGFHQNAGVIVLGATNRRDDLDQALLRPGRFDVEVMVSTPDFTGRKEILSLYLTKI 488
            |.:.||:.:||.......||...||..|.||.||:||||.||:..|.   :....::..::| :.
 Frog   308 TFSGLLNALDGVASTEARIVFMTTNHIDRLDPALIRPGRVDVKQYVG---YCTHWQLSQMFL-RF 368

  Fly   489 LHDEIDLDMLARGTSGFTGAD 509
            ..|:..::..|..::..:.:|
 Frog   369 YPDQTAVEAEAFASAALSSSD 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YME1LNP_001246473.1 FtsH_fam 254..736 CDD:273520 58/216 (27%)
bcs1lNP_001016865.1 BCS1_N 24..191 CDD:214980
AAA 226..355 CDD:365803 45/143 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.