DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC8-9 and AT5G51620

DIOPT Version :9

Sequence 1:NP_611731.1 Gene:EMC8-9 / 37635 FlyBaseID:FBgn0034791 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001331959.1 Gene:AT5G51620 / 835236 AraportID:AT5G51620 Length:160 Species:Arabidopsis thaliana


Alignment Length:58 Identity:21/58 - (36%)
Similarity:29/58 - (50%) Gaps:3/58 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LIDAHAEREGLVIAGYYAAPENFYDNQVDKTPAAK-IADKIQENFKNACFVVVDNKLM 122
            :|:.|...:||.|.||:.|.|.|.|  |:....|| |.|.|...|..|..::|...|:
plant     1 MIEEHYVAQGLSIVGYFHANERFDD--VELCGVAKNIGDHISRYFPQAPILLVSKCLI 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC8-9NP_611731.1 UPF0172 3..188 CDD:281640 21/58 (36%)
AT5G51620NP_001331959.1 MPN <1..>51 CDD:417455 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3289
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1284861at2759
OrthoFinder 1 1.000 - - FOG0002590
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12941
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.