powered by:
Protein Alignment EMC8-9 and AT5G51620
DIOPT Version :9
Sequence 1: | NP_611731.1 |
Gene: | EMC8-9 / 37635 |
FlyBaseID: | FBgn0034791 |
Length: | 203 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001331959.1 |
Gene: | AT5G51620 / 835236 |
AraportID: | AT5G51620 |
Length: | 160 |
Species: | Arabidopsis thaliana |
Alignment Length: | 58 |
Identity: | 21/58 - (36%) |
Similarity: | 29/58 - (50%) |
Gaps: | 3/58 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 LIDAHAEREGLVIAGYYAAPENFYDNQVDKTPAAK-IADKIQENFKNACFVVVDNKLM 122
:|:.|...:||.|.||:.|.|.|.| |:....|| |.|.|...|..|..::|...|:
plant 1 MIEEHYVAQGLSIVGYFHANERFDD--VELCGVAKNIGDHISRYFPQAPILLVSKCLI 56
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
EMC8-9 | NP_611731.1 |
UPF0172 |
3..188 |
CDD:281640 |
21/58 (36%) |
AT5G51620 | NP_001331959.1 |
MPN |
<1..>51 |
CDD:417455 |
19/51 (37%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3289 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1284861at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002590 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12941 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.010 |
|
Return to query results.
Submit another query.