DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC8-9 and EMC9

DIOPT Version :9

Sequence 1:NP_611731.1 Gene:EMC8-9 / 37635 FlyBaseID:FBgn0034791 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_057133.2 Gene:EMC9 / 51016 HGNCID:20273 Length:208 Species:Homo sapiens


Alignment Length:199 Identity:78/199 - (39%)
Similarity:107/199 - (53%) Gaps:13/199 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCDYKVSERAYAKLIFHAAKYPHQAVNGLLLAEKTSKGSQVEIVDAIPLFHQCLYVTPMAEVALM 65
            |.:.::|..||.|:..|||:|||.|||||.||.....|..:.:.|.:||||..|.::.|.||||.
Human     1 MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALN 65

  Fly    66 LIDAHAEREGLVIAGYYAAPENFYDNQVDKTP---AAKIADKIQENFKNACFVVVDNKLMTLQHD 127
            .:|....:.|||:||||.|  |...|  |::|   |.|||.:|.|.|.:|..:::||:.:..|..
Human    66 QVDVWGAQAGLVVAGYYHA--NAAVN--DQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPR 126

  Fly   128 RAAIQVFNCPGDSGARWSKAKFTLSQASDTLEG---VSLLLKRGAMRDLVDFDNHLDNPDKNWTN 189
            ...:.|..   :.|.||......|....|..|.   |..||:..|.:.|||||.|||:..::|||
Human   127 VPPVIVLE---NQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTN 188

  Fly   190 DFLN 193
            ..||
Human   189 QRLN 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC8-9NP_611731.1 UPF0172 3..188 CDD:281640 72/190 (38%)
EMC9NP_057133.2 MPN_UPF0172 6..188 CDD:163691 73/188 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141576
Domainoid 1 1.000 115 1.000 Domainoid score I6030
eggNOG 1 0.900 - - E1_KOG3289
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41095
Inparanoid 1 1.050 117 1.000 Inparanoid score I4810
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54791
OrthoDB 1 1.010 - - D1284861at2759
OrthoFinder 1 1.000 - - FOG0002590
OrthoInspector 1 1.000 - - otm41865
orthoMCL 1 0.900 - - OOG6_102725
Panther 1 1.100 - - LDO PTHR12941
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4556
SonicParanoid 1 1.000 - - X2308
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.